KEGG   Alcaligenes aquatilis: D3M96_03790Help
Entry
D3M96_03790       CDS       T05678                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K05712  3-(3-hydroxy-phenyl)propionate hydroxylase [EC:1.14.13.127]
Organism
aaqu  Alcaligenes aquatilis
Pathway
aaqu00360  Phenylalanine metabolism
aaqu01100  Metabolic pathways
aaqu01120  Microbial metabolism in diverse environments
aaqu01220  Degradation of aromatic compounds
Module
aaqu_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aaqu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    D3M96_03790
Enzymes [BR:aaqu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.127  3-(3-hydroxyphenyl)propanoate hydroxylase
     D3M96_03790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 DAO Pyr_redox_2 Pyr_redox_3 HI0933_like Thi4 NAD_binding_8 FAD_binding_2 UDPG_MGDP_dh_N Pyr_redox Lycopene_cycl TrkA_N 3HCDH_N ApbA NAD_binding_7 FAD_oxidored Rossmann-like GIDA
Motif
Other DBs
NCBI-ProteinID: AYN19736
UniProt: A0A3G2HRH9
Position
complement(837825..839498)
Genome map
AA seq 557 aa AA seqDB search
MGDINYQTLELTQAPPPATHARHPVVVVGAGPVGLTMALDLAAKGHQVVILDDDTSLSKG
SRAICFAKRTLDIWDRLGVGSRMMDKGVSWNVGKVFFRNQEVWSFNLRPEEGHQRPAFIN
LQQYYCEGYLYEAVCAQPLIELRSGHKVLNVVNQAEGVHLDIETQQGNYTLEAEWLLACD
GSRSAIRRALGESSSGRVFKDRFLIADVRMQADFPAERWFWFDPPFHPNQSVLLHSQPDN
VWRIDFQLGWDADPVEAVKPENVLPRIRALLGADAPFELEWVSIYTFACERMERFRHGRI
LFAGDSAHRVSPFGARGANSGIQDADNLAWKLNLVLNAQAPDSLLDSYSHERELAADENI
RHSSRSTDFITPKSEVSRLFRDAALILARRHAFARVLVNSGRLSLPSAYPDSPLNTADTH
EFSAKATPLGACVPDAPVQKNGQDDWWLAQLGAGFTLLEFGEGQVKQPEAIEELVAQGLL
TRLRVWPAGTSAALAQGGIIDSQDMLRQRYDAQLGSCYLIRPDQHLCARWRHLDGQAVQT
AIHKACGHFLESASCLH
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgggagacattaattaccagaccctggagctgacgcaagcgcccccaccggctacccat
gcccgccacccggtggtggtggtgggtgctggcccggtggggctgaccatggctctggat
ctggcggccaaaggccaccaggtcgtgattctggacgacgacaccagtctgtccaaggga
tcacgggccatttgctttgccaaacgcactctggatatctgggaccgattgggcgtgggc
tcacgcatgatggacaaaggcgtgtcctggaatgtgggcaaggtttttttccgcaaccag
gaagtctggagctttaatctgcggcccgaagaaggccaccagcgccctgcctttatcaat
ttgcagcagtactactgcgaaggctatctatacgaagccgtctgcgcccaacccctgatt
gagctgcgttccggccataaagtgctgaacgtggtgaatcaggcagaaggcgtgcatctg
gatatagaaacccagcaaggcaattacaccctggaagcagaatggctgctggcctgcgac
ggctcgcgctcggccattcgccgtgccttgggtgaaagcagtagcggccgcgtgttcaag
gaccgtttcctgattgcagatgtgcgcatgcaggccgacttccccgctgaacgctggttc
tggtttgacccgcccttccaccccaatcaatctgtcttgctacacagccagccggacaac
gtctggcgtatcgacttccaattgggctgggatgccgacccggttgaagccgtcaaaccc
gaaaacgtgctgccccgcattcgcgcccttctgggtgccgacgcccctttcgagctggaa
tgggtcagcatttacacctttgcttgcgagcgcatggagcgctttcgccatggccgtatt
ctgtttgccggggactcggcccaccgtgtctcgccttttggcgcacgcggcgccaatagc
ggtatccaggacgccgacaatctggcctggaagctgaatctggttctgaatgcccaggct
cccgacagcctgctggacagctacagccatgaacgcgagctggctgcagacgagaacatc
cgccactccagccgttcaaccgatttcattacccctaaaagcgaagtcagccgcctgttc
cgtgatgcggccctgattctggcgcgtcgccacgcctttgcccgtgtgctggtcaatagc
ggccgcctgtccttgcccagcgcctacccggacagccccttgaatacggctgatacacac
gagttttccgccaaggccacaccattgggagcctgcgtccccgatgcacctgttcagaag
aacggtcaggacgactggtggctcgctcaattaggagccggtttcaccctgctggagttt
ggcgaaggccaggtcaaacaacctgaagcaatcgaggaactggtcgcccaagggctgttg
acccgcctgcgcgtctggcccgcaggcactagcgcagccctggcccaaggcggcatcatc
gacagccaggatatgctgcgccagcgttacgacgcccagctcggttcttgctatctgatt
cgccctgatcaacacttatgcgcccgctggcgtcatctggacgggcaagctgtccagact
gccatacacaaagcctgtggccatttcctggagagtgcttcatgtctacactga

DBGET integrated database retrieval system