KEGG   Alcaligenes aquatilis: D3M96_04465Help
Entry
D3M96_04465       CDS       T05678                                 

Definition
(GenBank) molybdopterin adenylyltransferase
  KO
K03831  molybdopterin adenylyltransferase [EC:2.7.7.75]
Organism
aaqu  Alcaligenes aquatilis
Pathway
aaqu00790  Folate biosynthesis
aaqu01100  Metabolic pathways
aaqu04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:aaqu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    D3M96_04465
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    D3M96_04465
Enzymes [BR:aaqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.75  molybdopterin adenylyltransferase
     D3M96_04465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoCF_biosynth
Motif
Other DBs
NCBI-ProteinID: AYN19855
UniProt: A0A3G2HS60
Position
971875..972504
Genome map
AA seq 209 aa AA seqDB search
MTFNRQSPREYPDQLRIGLVSVSDRASSGQYQDQGIPALRRWLDSALTVAPAYLERLIPD
ERAQITGTLVELVEAGCDLILTTGGTGPARRDVTPEATVDAGTREMPGFGEQMRQISLKF
VPTAILSRQVAVIREIQDHAALIINLPGQPKAIQETLEGLRDTETGQVLVPGIFAAVPYC
IDLIGGPYAQTHEHVVQAFRPKSARRTAS
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgacattcaatcgacagtctccccgcgagtatccggatcaattgcgtatcggcttggtg
tcggtttcggatcgcgcttccagcggacagtaccaggatcaaggtataccggcgctgcgc
cgctggctggattccgccttgacggttgcacctgcctatctggagcgcttgattcctgat
gagcgagcccagattaccggcaccttggtcgaactggtggaagcgggttgcgacctgatt
ttgaccaccggtggcacgggcccggcccgtcgtgacgtgacgccggaggccacggtggac
gcgggaacgcgcgaaatgcccggattcggtgaacagatgcgtcaaatcagtttaaaattc
gtaccaacagcgattttgtcgcggcaagttgcggtcatccgagaaattcaggaccacgct
gctctgattatcaatctgcctgggcagcccaaagccattcaggaaacactggaaggatta
cgggatacagaaaccggacaagtattggtgccgggtatttttgcagctgtcccgtattgc
atcgatctgatcggcggaccttacgcacaaactcacgagcatgtggtgcaagcgttccgc
cccaagtcggcgcgtcggaccgccagttaa

DBGET integrated database retrieval system