KEGG   Alcaligenes aquatilis: D3M96_11560Help
Entry
D3M96_11560       CDS       T05678                                 

Definition
(GenBank) glutamine amidotransferase
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
aaqu  Alcaligenes aquatilis
Pathway
aaqu00230  Purine metabolism
aaqu01100  Metabolic pathways
Module
aaqu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:aaqu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    D3M96_11560
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aaqu01002]
    D3M96_11560
Enzymes [BR:aaqu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     D3M96_11560
Peptidases and inhibitors [BR:aaqu01002]
 Cysteine peptidases
  Family C26: gamma-glutamyl hydrolase family
   D3M96_11560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26 GATase_3 Arteri_env
Motif
Other DBs
NCBI-ProteinID: AYN21106
UniProt: A0A3G2HVB0
Position
2542713..2543465
Genome map
AA seq 250 aa AA seqDB search
MIDVHFLQAGSPPPDVEQRFGNQNAWFKRALQALEVNVHTWRVHQDKALPAADCPDPVVI
SGSWSMVTDEPDWSENLAAWIRERYQTPMPLLGICYGHQLMAHALGGRVDYHPLGAEVGY
LPIHLSEQAHEHELLAHLPMQFPALLTHQQSVLSLPDHVQVLGSSAHDPYQILRYSPAQW
SIQFHPEFFAGLLRYCVLRKAESWRAQGIDPKTLADPIQDTPDARRLLCHFVQTYSSSGP
SGRRKNSPGV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgatagacgtgcattttctgcaagccggctcccctccaccggatgtggagcaacgtttc
gggaatcagaacgcctggttcaaacgtgccttgcaagctctggaggtgaatgtccacact
tggcgagtccatcaggacaaggccctgcccgcagcagactgcccggaccctgtcgtgatc
agcggttcctggagcatggtcactgacgagccggactggagcgaaaatctggccgcctgg
attcgggagcgctatcagacccccatgcctttgctgggtatttgctacggtcatcaatta
atggctcacgccttgggcggacgtgtggattaccaccctctgggggccgaggtgggctat
ctacccattcacctgtccgagcaggcgcacgagcatgagttgctggcccatctgcccatg
cagttcccggccctgctcacgcaccagcaaagtgtgctgagtttgcccgaccatgtgcaa
gtgctgggcagttccgcccacgatccctatcaaatcctgcggtacagccctgcgcaatgg
tcgatccagtttcatcctgagttttttgccggcctgctgcgatactgcgtgctgcgaaag
gctgagtcctggcgagcccagggcatagacccgaaaaccctggcagaccccattcaggac
acgcctgacgcccgtcgtctgctgtgccattttgtgcagacttactcgtccagcggcccc
agtggacgacggaaaaattcgccaggggtttga

DBGET integrated database retrieval system