KEGG   Alcaligenes aquatilis: D3M96_12270Help
Entry
D3M96_12270       CDS       T05678                                 

Definition
(GenBank) deaminated glutathione amidase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
aaqu  Alcaligenes aquatilis
Brite
KEGG Orthology (KO) [BR:aaqu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    D3M96_12270
Enzymes [BR:aaqu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     D3M96_12270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AYN21229
UniProt: A0A3G2HW49
Position
complement(2690861..2691649)
Genome map
AA seq 262 aa AA seqDB search
MKVALGQMAVSRDSQENLSACLGLIEQALRSDAQLLVLPEGVLARNVADPEVVLKSAQAL
DGEFVSRLSVATRDTDLTVVFCIHTPAGEGKVWNTLVVLRDGQVLAHYNKLHLYDAFSVQ
ESRYVQPGTEIPALIDVAGFKVGLMTCYDLRFPELARRLCVDGAQVLLAPSAWLKGPLKE
HHWRVLTTARALENTAYMVAVGECGERNIGQSLVVDPLGVIVAQAAEAPALLLVDLDRER
LAYARRILPVLENRRFAPPELG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgcattgggccagatggccgtatccagagattcgcaggaaaacctgagcgca
tgcttggggttgatcgagcaggccttacggtctgatgcgcagttattggtgttgcctgag
ggtgtgctggccagaaatgtggccgaccccgaagtggtcctgaaatccgcgcaggccctg
gacggggaatttgtcagccgcctgagcgttgcgacccgcgataccgatttgaccgtggtg
ttttgcattcatacgccggcaggggagggtaaggtctggaataccttggtggtgctgcgt
gatggtcaggtgctggcgcattacaacaagctccatttgtatgatgccttttcggtgcag
gagtcgcgctatgtccagccgggcactgaaatccctgccttgattgatgtggccggtttc
aaggtcggtttgatgacttgctacgatctgcgttttcctgaactggccagacgcttgtgc
gtggatggggctcaagtcttgctggcgccttcggcctggctgaaaggaccgttgaaagag
caccattggcgtgtgctgacgacggcgcgtgctttggagaacacggcctatatggtagcc
gtgggggaatgtggcgaacgcaatatcggccaaagtctggtggtggatcctttgggcgtg
atcgtggcccaggcggcagaggcaccggccctgctgttggtggatctggatcgggagcgt
ctggcgtatgctcgccggattttgcccgtgctggaaaaccgtcgttttgcaccgcccgaa
ctgggttga

DBGET integrated database retrieval system