KEGG   Alcaligenes aquatilis: D3M96_12790Help
Entry
D3M96_12790       CDS       T05678                                 

Gene name
rfaD
Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
aaqu  Alcaligenes aquatilis
Pathway
aaqu00540  Lipopolysaccharide biosynthesis
aaqu01100  Metabolic pathways
Module
aaqu_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:aaqu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    D3M96_12790 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:aaqu01005]
    D3M96_12790 (rfaD)
Enzymes [BR:aaqu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     D3M96_12790 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:aaqu01005]
 Unusual sugar
  D3M96_12790 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 Ldh_1_N NAD_binding_10 KR
Motif
Other DBs
NCBI-ProteinID: AYN21324
UniProt: A0A3G2HW85
Position
complement(2809992..2810990)
Genome map
AA seq 332 aa AA seqDB search
MIVVTGGAGFIGSNLVKGLNQQGVTDILVVDDLSDGDKFVNLVHGQIADYMDKDDFRARL
ARDEFSNIEAVLHQGACSDTTERNGQFMMDNNYRVTLEIFEYCQAKRIPLLYASSAAVYG
AGPLYAEDLSNEAPLNVYGYSKFLFDQVLRRHLDRLSAPVVGLRYFNVYGPQEQHKGRMA
SVAYHNMLQYRRDGHVLLFGGWDGYVDGGQQRDFVFIDDVVSVNLHFLGQDKQSGVFNCG
SGRAQPFNDVAQTVVNTLREHDGLPALELEDLVTQQFLQYIPFPDDLKGRYQSHTQADLT
QLRAAGYDKPFHDVQTGVAEYVRRLLQSGALR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtagtgaccggtggcgctggctttattggcagcaatttggtgaagggcctgaat
cagcagggtgtgaccgacattctggtggtggacgacctgagcgatggcgacaagttcgtc
aatctggtgcatggtcaaattgccgactatatggacaaggatgatttccgtgcccgtttg
gcgcgggacgagttctccaatattgaagctgtgctgcatcagggcgcatgttcggacact
accgagcgcaatggtcagttcatgatggacaataactatcgcgtgacactggaaatcttc
gagtattgccaggccaagcgtattcctctcttgtacgcttcgtccgccgctgtttacggt
gcaggcccgctgtacgccgaagaccttagtaacgaagcccctttgaatgtctacggttat
tccaagttcctgttcgaccaagtgctgcgtcgtcatctggatagactgagcgcaccagtg
gtgggtttgcgctactttaatgtctacggtccacaagagcagcacaagggtcgcatggca
tcggtggcttaccacaatatgctgcaataccgccgtgacggtcatgtgctgctgttcggt
ggttgggatggttatgtggatggtggccagcagcgcgacttcgtctttattgatgacgtg
gtgtcggtgaatctgcatttcctgggtcaagacaagcagtctggtgtttttaattgcggt
tcgggtcgtgctcagccgttcaatgatgtggcccaaacggtcgtcaataccttgcgcgaa
cacgatggtttgcctgccttggaattggaagatttggtgacgcaacagttcctgcaatac
atcccgttcccggatgatttgaaaggccgttatcaaagccacacgcaggctgacttgact
caattgcgtgccgctggctacgacaagcctttccatgatgtgcagaccggcgtggccgag
tacgtacgtcgtctgcttcagtcaggcgctctgcgttaa

DBGET integrated database retrieval system