KEGG   Alcaligenes aquatilis: D3M96_16760Help
Entry
D3M96_16760       CDS       T05678                                 

Definition
(GenBank) carbohydrate kinase family protein
  KO
K00856  adenosine kinase [EC:2.7.1.20]
Organism
aaqu  Alcaligenes aquatilis
Pathway
aaqu00230  Purine metabolism
aaqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aaqu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    D3M96_16760
Enzymes [BR:aaqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.20  adenosine kinase
     D3M96_16760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: AYN22037
UniProt: A0A3G2HY90
Position
complement(3653708..3654649)
Genome map
AA seq 313 aa AA seqDB search
MTERVLVCGSIAFDTIAVFEGYFKDHILPDSIKTLSVSFFVPSLRKEWGGCAGNMAYTLN
MLGGRPVPVGAVGSDGVDYVQRLQDLGIDTSMVRVMPDMFTPQCFITTDLAASQITSFHP
GAMISSAQIDLSGQEAAWGIVAPDSKDGMFAHARRLNAQGTPFIFDLGQAMPLFTGEDLL
EMLELCQVLTANEYEAEVIEQRTAKSMAEIAQGLQAAIVTRGEYGSTLYHNGQAYDIAPV
PVDHVVDPTGCGDAHRAGLLYGLTKGWSWQEACCLGNLMGSIKIQVDGPQNHEFKRSDIS
AMLKQHYGIERSL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcgagtgctggtatgtggttcgatcgcgtttgatacgatcgcggttttcgag
gggtacttcaaagatcacatcttgcccgatagcatcaaaaccctgagtgtgtcctttttt
gtgcccagtttgcgtaaagagtggggcggctgtgctggcaacatggcctatacattaaat
atgctgggtggccgtcctgtgcccgtgggggcggtaggtagcgacggtgtggattatgtg
cagcgtttgcaggatctggggattgataccagcatggtgcgcgtgatgcctgatatgttc
acccctcagtgctttatcactacagacttggctgccagccagattacctctttccacccg
ggtgccatgatcagttcggcccaaattgatctgtccggtcaagaagcggcgtggggcatt
gtggctccggactccaaagatggtatgtttgcgcatgctcgtcgcctgaacgcacaaggc
acgccgttcattttcgacttgggccaagccatgcctttgtttacgggcgaagatctgctg
gaaatgttggaactgtgtcaagttcttacggcgaacgaatatgaagccgaagttattgag
caacgtaccgccaagagcatggccgagatcgcacagggtttgcaggccgctattgtgacg
cgtggggagtatggaagcacgctttaccacaacgggcaggcttatgacattgcccctgtg
ccagtggaccatgtggttgatcctaccggctgtggcgatgcccatcgcgcaggtttgtta
tatggacttacaaaaggttggagctggcaggaggcttgctgcttgggcaacttgatgggc
agtattaaaatccaggtcgatggcccgcaaaatcatgaatttaaacggtcagatatctcg
gccatgctaaaacagcactatgggattgagcgcagtctgtaa

DBGET integrated database retrieval system