KEGG   Alcaligenes aquatilis: D3M96_19495Help
Entry
D3M96_19495       CDS       T05678                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
aaqu  Alcaligenes aquatilis
Pathway
aaqu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:aaqu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    D3M96_19495
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:aaqu03011]
    D3M96_19495
Ribosome [BR:aaqu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    D3M96_19495
  Bacteria
    D3M96_19495
  Archaea
    D3M96_19495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AYN22547
UniProt: A0A3G2HZQ7
Position
complement(4253850..4254179)
Genome map
AA seq 109 aa AA seqDB search
METTAIIRGVHISAQKARLVADMVRGKSVAHALNTLTFTPKKAAGIIKKALESAIANAEH
NDGADIDELKVTSIYVDKAQSLKRFSARAKGRGNRIEKQTCHIVVKVGA
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaaactacagcaattattcgtggagtccatatttcggcgcaaaaagcacgtctggtt
gcggacatggtccgcggcaagtccgtcgctcacgctctgaatacgctgactttcactcct
aagaaagccgctggcatcatcaagaaagctctggaatcggctattgccaacgctgagcac
aatgacggcgccgatatcgacgaactgaaagtcacctccatttacgtggacaaggctcag
tcgttgaagcgtttttctgcacgagccaaaggccgcggtaaccgtattgagaagcagact
tgccacattgtggtcaaagtcggcgcttaa

DBGET integrated database retrieval system