KEGG   Acetohalobium arabaticum: Acear_0139Help
Entry
Acear_0139        CDS       T01290                                 

Definition
(GenBank) glutamyl-tRNA synthetase; glutamate--tRNA(Gln) ligase
  KO
K09698  nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
aar  Acetohalobium arabaticum
Pathway
aar00970  Aminoacyl-tRNA biosynthesis
aar01100  Metabolic pathways
Module
aar_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:aar00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Acear_0139
Enzymes [BR:aar01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Acear_0139
Amino acid related enzymes [BR:aar01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Acear_0139
Transfer RNA biogenesis [BR:aar03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Acear_0139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c PM0188 Imm-NTF2 HBS1_N
Motif
Other DBs
NCBI-ProteinID: ADL11690
UniProt: D9QT02
Position
155390..156856
Genome map
AA seq 488 aa AA seqDB search
MSDIRVRFAPSPTGQIHIGNIRTALFTWLYARKHNGTTVLRIEDTDQERSTSEFEEIILQ
ETDWLGLDWDEGVRAGGDYGPYRQSDRLDIYDKYIDRLIEEDKAYYCYCTDEELEQMREE
AKAKGKPPKYNGRCRNLSEEERKELEAEGREPAVRFKMPTEEIKIVVNDLVHGEVEFSSE
VLDDFVIVKSDGLPTYNFAVVIDDHLMEISHVIRGEDHLSNTPKQQLIYDALDWEMPEFG
HLPMILGEDKSKLSKRSGEAYVYVSEYRQKGYLPEALINFLALLGWSSADDEELFTVEEI
IDNFSMERVNNSPSVFDVEKLNWMNGHHIRESELDRIVDLAIPYLQEAGYIADELSDEEY
NYVAQIVDVVRDSLDYVAQITDHVDIFFGELEYENKEEVIDCFQQEDVDLVLETLKDRLA
VLDDYSPDSVLEEMRAILNDLPVGGRLFYHPTRYALTGKGSGPELYQVVSILGKEETINR
LDKALNLV
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatattagagtaagatttgcaccaagtcctacgggacagattcatattggtaat
attcgtactgctttatttacctggttatatgctagaaagcataacggaactacagtctta
aggattgaagatactgatcaggaacgttctacgtctgaatttgaagagattattctgcag
gaaacagactggctcggcctggattgggatgaaggtgtgcgggctggcggtgattatggt
ccatatcgtcagagtgataggcttgatatatatgataaatacatagataggttaatcgaa
gaagataaagcttactactgttattgtactgacgaagaattggagcaaatgagagaagag
gcaaaagctaaaggcaaaccgcctaagtataacggaagatgtcgtaatttatctgaagaa
gaaagaaaagaattagaagctgaaggaagagagcctgctgttagattcaagatgcctacg
gaagaaataaagattgtagttaatgatctagttcatggtgaggtagagtttagcagtgaa
gttttagatgattttgtgattgtaaagtcggatggactaccgacttataactttgcagta
gtgattgatgatcatttaatggaaattagccatgtgatccgtggagaggaccatctgtcc
aatactcccaagcagcagttgatttatgatgctttagattgggaaatgcctgaatttggt
catctaccgatgattctaggtgaggataaatctaagttaagcaaacggagtggagaagcc
tatgtttatgttagtgaataccgccaaaaaggttatctcccggaagcattgattaacttt
ttagccttattgggttggtcttctgctgatgatgaagaattatttactgtagaagaaatt
atagataacttttcaatggagagagtaaataatagcccatcagtttttgatgtagagaag
ttaaattggatgaatggacatcatattagagagtctgagctggatagaatagtagactta
gcaattccttatctgcaggaagcaggttatattgctgatgagctaagtgatgaggagtat
aactatgtagcccaaatagttgatgtagtccgcgattcactggattatgtagcccagatt
acggaccatgtagatatcttctttggtgaattggaatatgaaaacaaagaagaagttata
gactgttttcagcaggaggatgttgatttagtactggagactttaaaggaccgcttagct
gtattagatgattatagtccggattcggttttagaagaaatgagggctattttgaatgat
ttaccggttggaggcagactcttttatcatcctactcgctatgccttgactggcaaggga
tcaggacctgaattatatcaagtagtttctattctaggtaaggaagaaaccattaatcga
cttgataaagcccttaatttagtttaa

DBGET integrated database retrieval system