KEGG   Acetohalobium arabaticum: Acear_1494Help
Entry
Acear_1494        CDS       T01290                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
aar  Acetohalobium arabaticum
Pathway
aar00561  Glycerolipid metabolism
aar00640  Propanoate metabolism
aar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Acear_1494
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Acear_1494
Enzymes [BR:aar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     Acear_1494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ADL13003
UniProt: D9QR62
Position
complement(1590421..1591518)
Genome map
AA seq 365 aa AA seqDB search
MSSTVGFPNYTIENGAIEKLGKLCSKYGEKVLVIGGKTALSKTEEEIKNTLKTNDLEIID
FIWYGGECTLHNIELKRKKAVETEADLIIGVGGGKALDTAKGAAEKADLPIFTVPTIAAT
CAATTPLSILYTAKGDFDSFFHLTKPPVHIFIDTKVIANAPAKYLRGGIGDTVAKHYEVE
IKSRPDELAHASALGKEMSTMCVEPLVEYGFQALKDCRENDVSFALKQVVLNNIITTGLV
SMLVKEKYNGACAHSLCYGLTLIERLEEEFLHGELVAYGLLVQLIIDERENEFNKLYHFF
DQVGLPVSLDHFKLEVNRKDLESILKEAVAGEDMIDMPYQVTEDDFYEAIKRLEMINKGE
EEYGE
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaacagttgggtttcctaattacaccatcgaaaatggagcaatagagaagtta
ggaaagctatgtagtaagtatggagaaaaggttttagttattggtggtaagactgcttta
tctaaaactgaagaagagattaaaaatactttaaagaccaatgacctagaaattattgat
tttatatggtatggtggtgaatgtactttacataatattgaattaaaaagaaagaaggct
gtagaaactgaagctgatttaattattggtgttggtggagggaaggctcttgatacagcg
aagggagcagctgaaaaggctgatttacctatctttactgtaccaacaattgctgctacc
tgtgctgctactactccgctgtctattctttatacagctaagggagatttcgattcattc
tttcatttaactaagccgccagtacatatctttattgatactaaagtaattgctaatgct
ccagctaaatatttacgtgggggaattggggatacagtagccaaacattatgaagtagaa
ataaagtccagaccagatgaacttgctcatgcttcggctctgggtaaagagatgagtact
atgtgtgttgaaccattagtggagtatggttttcaggccttaaaagactgtagggagaat
gatgtttcctttgctttaaaacaggttgtccttaataatattattaccactggtttggta
tctatgttggtaaaagagaagtataatggtgcttgtgcccattcattatgttatggttta
actttaattgaaaggttagaggaggagttcctacatggtgaattggtagcttatggtctc
ttagtccagttaataatagatgaaagagagaatgaattcaataagctttatcacttcttt
gaccaagtaggacttccagtttcattggaccactttaaacttgaagtgaatagaaaagac
ctagaatcaatattaaaagaagcagtagctggtgaagatatgattgatatgccttaccaa
gttactgaagatgatttttatgaggcaattaaaaggttagaaatgatcaataagggggaa
gaagagtatggagagtaa

DBGET integrated database retrieval system