KEGG   Acetohalobium arabaticum: Acear_1688Help
Entry
Acear_1688        CDS       T01290                                 

Definition
(GenBank) diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
aar  Acetohalobium arabaticum
Pathway
aar00300  Lysine biosynthesis
aar01100  Metabolic pathways
aar01110  Biosynthesis of secondary metabolites
aar01120  Microbial metabolism in diverse environments
aar01130  Biosynthesis of antibiotics
aar01230  Biosynthesis of amino acids
Module
aar_M00527  Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:aar00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Acear_1688
Enzymes [BR:aar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     Acear_1688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC Ala_racemase_N
Motif
Other DBs
NCBI-ProteinID: ADL13193
UniProt: D9QRQ2
Position
complement(1783060..1784373)
Genome map
AA seq 437 aa AA seqDB search
MVLHGTMEVNEKGNLEVGGCDVTNIATEYGTPLYILDEEELRDNCRAYRQAFEEWYPNSE
TIYASKAFMSLTICKIVEEEGLGLDVVSGGELYTALEADFPTDKIYFHGNNKTPEELEMV
LNEEIGRIVVDNNYELELLNELADQQGKRADILIRVTPGVEAHTHSYIQTGQTDSKFGVG
IQNGLALETVKKAVELENIDVKGIHCHIGSQIFNLESFEVAVDVMLDFVEEVKIETGLVM
EELNIGGGIGIKYTDKDQSVSIDQYAELVAKAIKQKCEEINIPLPKIINEPGRSIIGTAG
STIYTVGSIKNIPDVRKYVAVDGGMPDNIRPALYEAEYEAIVANKANRKPEEVVSITGKC
CESGDMLIWDIELPEMEPGDVLLTPCTGAYGYAMANNYNSLPKPGVVLINNGQVEEIIRG
ERYEDLVAKEEIPARLK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggtattacatggaacaatggaagtaaatgaaaaaggaaatttagaagttggaggatgt
gatgtaactaacatagctacagaatatgggacgccgctatatattcttgatgaagaggag
cttagagataactgtcgggcatatcgccaggcttttgaagaatggtatcccaactcagaa
actatttatgctagtaaggcttttatgtcgcttacaatctgtaaaattgttgaagaagaa
ggattaggtttagatgttgtatcaggcggtgaattatatactgctttggaagcagacttt
ccgacagataagatctactttcacggcaataataagactcctgaggagttagagatggtc
ttaaatgaagaaataggtcgaatcgtagtcgataataattatgaactggaactgttgaat
gaattagcagaccagcagggaaaaagagcagatatattaattagagttactccgggtgtt
gaggcccatactcatagttatatccaaacaggccagacggattccaagttcggagttggt
attcagaatggattggccttagaaacagttaagaaggctgttgaattagaaaatatagat
gtcaagggaattcactgccatattggttcccagatctttaatctggagtcttttgaggta
gcagttgatgtaatgcttgattttgtagaagaagttaagatcgaaaccggattagtaatg
gaagaattgaatataggcggcggtattggaattaagtatactgataaggatcaatcagta
agtattgatcagtatgctgagttagtagctaaagctattaaacagaagtgtgaagagatt
aatattcccctacctaagataatcaacgaaccgggacggtcaattatcggaacagcagga
tcaactatttatacagtaggttccattaagaatattcctgatgttcgaaagtatgtagca
gttgacggcggaatgcctgataatattcggccggctctttatgaagcagagtatgaagcc
attgtagctaataaagccaaccggaagcctgaggaagtagtttcgattaccggtaaatgt
tgcgaatcaggagatatgttaatctgggatattgaattgcctgaaatggagccgggagat
gttctattaactccttgtaccggtgcctacggctatgcaatggccaataattataatagt
ctacctaaaccgggagtcgtactgattaataacggtcaggtagaggagattatccgggga
gaaagatatgaagatctggtagcaaaagaagagattcctgctcgattaaagtaa

DBGET integrated database retrieval system