KEGG   Acetohalobium arabaticum: Acear_1839Help
Entry
Acear_1839        CDS       T01290                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aar  Acetohalobium arabaticum
Pathway
aar00071  Fatty acid degradation
aar00280  Valine, leucine and isoleucine degradation
aar00310  Lysine degradation
aar00362  Benzoate degradation
aar00620  Pyruvate metabolism
aar00630  Glyoxylate and dicarboxylate metabolism
aar00640  Propanoate metabolism
aar00650  Butanoate metabolism
aar00720  Carbon fixation pathways in prokaryotes
aar00900  Terpenoid backbone biosynthesis
aar01100  Metabolic pathways
aar01110  Biosynthesis of secondary metabolites
aar01120  Microbial metabolism in diverse environments
aar01130  Biosynthesis of antibiotics
aar01200  Carbon metabolism
aar01212  Fatty acid metabolism
aar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Acear_1839
   00630 Glyoxylate and dicarboxylate metabolism
    Acear_1839
   00640 Propanoate metabolism
    Acear_1839
   00650 Butanoate metabolism
    Acear_1839
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Acear_1839
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Acear_1839
   00072 Synthesis and degradation of ketone bodies
    Acear_1839
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Acear_1839
   00310 Lysine degradation
    Acear_1839
   00380 Tryptophan metabolism
    Acear_1839
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Acear_1839
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Acear_1839
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Acear_1839
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aar04147]
    Acear_1839
Enzymes [BR:aar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Acear_1839
Exosome [BR:aar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Acear_1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ADL13343
UniProt: D9QS52
Position
complement(1927279..1928457)
Genome map
AA seq 392 aa AA seqDB search
MEEIVIASAVRTAIGSFGGSLKKVSAIELGTTTIKAALERAELDAGEVDEVIMGNVLQAG
SGQNPARQASVNAGLPVETPAMTINKVCGSGLKAVNLAAQAIKAGDGDVFVVGGMENMSQ
APYVQNKARWGERMGHGKLVDTMIQDGLWCAFNDYHMGITAENVAEQWDISREEQDEFAA
TSQQRAEAALEEGKFEDEIVPVEVPQRKGDPVVFDKDEYPRSGVTAEGLANLRPAFKKDG
TVTAGNASGINDGAAALVVMTKSKAEELGVEPLATIKSYASAGVDPAIMGTGPIPSSKKA
LQEADLTVEDMDLVEANEAFASQSLAVVQDLGLDTEKVNVNGGAIALGHPIGASGARILI
TLLHEMKKQDSKYGLATLCIGGGQGAATVVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaattgtaattgcaagtgcagtgagaacagcaattggcagttttggtggaagt
ttaaagaaggtttctgctattgagttgggaacaactacaattaaagcagctttagaaaga
gctgaattagatgctggtgaagtagatgaagtaattatggggaatgtcttacaggctggt
tcaggccagaacccggctcgtcaggcatcagttaatgccggcttacctgtggagacaccg
gctatgactatcaataaagtctgtggttcaggtctaaaggcagttaatttagctgcccag
gcaattaaagccggagatggagatgtatttgttgttggcggtatggagaatatgagccag
gcgccttatgttcagaataaagcccgctggggagagagaatgggccacggcaaattagta
gatacaatgattcaagacggcctttggtgtgcattcaatgattatcatatgggtattact
gctgaaaatgtagctgaacagtgggatattagtcgtgaggaacaggatgagtttgctgca
accagtcagcagagagctgaagcggcattagaggaaggtaaattcgaagatgagatagta
cctgtagaagtaccgcagcgaaaaggagacccagttgtattcgataaagatgaatatccc
cgcagtggagtaacagctgaaggattggctaacttacgtccggcctttaagaaggatgga
acagtaactgccggtaatgcatcaggaatcaatgacggagcagctgcattagtggtaatg
actaagagtaaagctgaggaattaggagtagagccactggctactattaagagttatgct
tcagcaggagtagatccagctattatgggaaccggcccgattccttcttctaagaaggca
ttacaggaggcggacttaacagtagaagatatggacttagtagaagccaatgaagctttt
gcatcccagtctcttgcagtagttcaagatttaggattggatactgaaaaggtaaatgta
aatggaggagcaattgctttaggccatccgattggtgctagtggagcaaggatcttaatt
actctgttacatgagatgaagaagcaggactctaagtatggactagccactctttgtatc
ggcggtggacagggagctgctacagtagtagaaagataa

DBGET integrated database retrieval system