KEGG   Acetohalobium arabaticum: Acear_2144Help
Entry
Acear_2144        CDS       T01290                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase (GDP); mannose-6-phosphate isomerase, type 2
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
aar  Acetohalobium arabaticum
Pathway
aar00051  Fructose and mannose metabolism
aar00520  Amino sugar and nucleotide sugar metabolism
aar01100  Metabolic pathways
aar01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Acear_2144
   00520 Amino sugar and nucleotide sugar metabolism
    Acear_2144
Enzymes [BR:aar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     Acear_2144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADL13632
UniProt: D9QTR1
Position
complement(2253597..2254673)
Genome map
AA seq 358 aa AA seqDB search
MITPLIMAGGVGSRFWPLSRKDTPKQFLKLVDQDQSMIQATVDRISDLSSYENIFIATNQ
NYLADIKEHLPEIPENNITVEPMGKNTAACIGLASLYIEQQDPQAVMVVLPSDHLIEDES
SYLEILNTAVEVAKKGDNLVTIGIEPTQPETGYGYIAYDQDEREIEIDNAFAVKEFTEKP
DLKTAENFIEQGNYLWNSGMFVWRVDTIRKMFKKYMPNLHKGLERMKEAIGTEQEEEVLV
EEFKKLDSISIDYGIMEQADNIYVVPGDFGWDDVGTWSSLERFKEVDLDGNLVEGNHIGL
ETKNSIIHGNGKLITTVGLDNVIIVETDDAIMVCDKDKAQDVKELRNKLKSEGYEDCL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgattacaccactaatcatggccggaggagttggtagtagattctggcctttaagcaga
aaggatactcctaaacaatttttgaaattagttgatcaagaccagagtatgattcaggct
acagtagatagaattagtgatttaagctcctatgaaaatattttcattgctactaatcaa
aattatttggctgatattaaagaacatttaccagagattcctgagaataatattaccgtc
gaacctatgggcaagaatacagcagcctgtattggactagcttcactatatattgaacag
caggacccacaggcagtgatggttgtgctgccttcagatcatttgatagaagatgaaagt
agttatttagagatactaaacacagcagtagaagtagctaaaaaaggagataacttagtg
actatcggtattgaaccaactcagcctgaaaccggttatggctatattgcctatgatcag
gatgaaagagagattgaaattgataatgcttttgcagttaaagagtttaccgaaaagccg
gacctgaagacagctgagaactttatagagcagggtaattatctctggaacagcggtatg
tttgtctggcgggtagatactattcgcaagatgttcaaaaaatatatgcctaacctacat
aagggattagaaagaatgaaagaagcaatcggtactgagcaggaagaggaagtattagtc
gaagagttcaaaaaattagacagcatctctatagattatggaattatggaacaggccgat
aatatctatgttgttcccggtgattttggttgggatgatgtaggtacctggtcatcattg
gagcgctttaaagaggtagatttagatggtaacttagttgaaggtaatcatattggtctt
gaaactaagaactctattattcacggcaatggtaagttaattactaccgtagggctagat
aatgtgattattgtagagactgatgatgcaattatggtttgtgataaagataaagcccag
gatgtaaaagaactacggaataaattaaagagtgaaggctatgaagactgcctataa

DBGET integrated database retrieval system