KEGG   Candidatus Amoebophilus asiaticus: Aasi_0642Help
Entry
Aasi_0642         CDS       T00730                                 

Definition
(GenBank) hypothetical protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aas  Candidatus Amoebophilus asiaticus
Pathway
aas00020  Citrate cycle (TCA cycle)
aas01100  Metabolic pathways
aas01110  Biosynthesis of secondary metabolites
aas01120  Microbial metabolism in diverse environments
aas01130  Biosynthesis of antibiotics
aas01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Aasi_0642
  09105 Amino acid metabolism
   00310 Lysine degradation
    Aasi_0642
   00380 Tryptophan metabolism
    Aasi_0642
Enzymes [BR:aas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Aasi_0642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ACE06039
UniProt: B3ES37
Position
826684..828036
Genome map
AA seq 450 aa AA seqDB search
MVVQKLSLHKNISMKELAIAMPKMGESVMEATIIKWLKKEGDEIAEAESILEVATDKVDS
EIPAPYTGKLKKILVQVGQVVAVGAPIAIFEVEDTTLLGNGQSISQSKIASQALPATKSF
ASSDSRPVKHTVQLHERTACPLYDTAGRFYSPLVRYIAQKESLSLEEMENIPGTGKDNRV
TKQDLLTYLAHRRSTQRSSSYSNLTIESIQQYAKPGDEIIPMDRVRKIIAERMVAAMHTV
PHVTSFVEADVTELVAWREKNKLAFKQKTGIGLTYTPLFVKAVAQAIQKFPLINVSVVGE
YIIKRKAINIGLAVALPDGNLIVPVVKNADQLTLSELAICIHKLVHNARHGQLLPDDIAD
GTYTISNIGSFQNLMGTPIIMQPQVAILAVGSIVKKPAVIETAQGEQITIRHQMYLSHTY
DHRVVDGALGGQFAKAVADYLEKFDFAKES
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggtagtacaaaaattaagtctacataagaatataagtatgaaagaattagcaatagct
atgcccaaaatgggtgaaagtgtaatggaagccactattatcaagtggcttaaaaaggaa
ggagatgaaattgcagaagctgaatctatactagaagtagctacagataaagtggattcg
gaaatacctgccccttatacagggaagctaaagaagattttggtacaagtaggccaggta
gtagctgtaggagctcccatagcaatttttgaagtagaagacacaaccttattaggcaat
ggacaatctatatctcaatctaagatagcttcgcaggctcttcctgctactaagtctttt
gcttcttctgattctcgacctgtcaaacatactgtgcaattacatgagcgtactgcctgc
cctctctatgatacagctggtagattttactcacccttagttcgatatatagctcaaaaa
gagtctctttcattagaggagatggagaacattcctggtacagggaaagataatcgcgta
accaagcaagatcttcttacatatttagcacatagaaggagtacccaacgcagctctagt
tatagcaatcttaccatagaaagtatacaacaatatgctaagccaggggatgagattata
ccaatggatagggtaagaaaaattattgcggagcgaatggtagcagccatgcatacagtt
ccacatgtaacctcttttgtagaggctgatgtaactgaattagtagcatggagagagaaa
aataaattggcatttaagcaaaaaacaggtataggacttacttatacacctctttttgta
aaagctgttgcacaggccatacaaaaattccctctaattaatgtgtcggtagtaggagaa
tacattattaaacgtaaagctatcaatataggcttggctgttgctctgccagatggaaat
ctaattgtgccagttgttaaaaatgcagatcaacttactttgtctgagttggctatatgt
attcataagttagtgcataatgctcggcatggacagcttttgccagatgatattgcagat
ggtacttatactatttctaacataggctcttttcaaaatttgatgggaacacccattatt
atgcagccgcaggtagctattttagcagtaggtagtattgtaaaaaagcctgctgttatt
gaaacagcacaaggtgaacaaattaccattcgtcatcaaatgtacctatcccatacatat
gatcatcgtgtagtagatggtgctttaggtggacagtttgctaaggctgtggctgattat
cttgaaaaatttgattttgctaaagaaagttga

DBGET integrated database retrieval system