KEGG   Acetobacter ascendens: A4S02_10310Help
Entry
A4S02_10310       CDS       T05523                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
aasc  Acetobacter ascendens
Pathway
aasc00260  Glycine, serine and threonine metabolism
aasc01100  Metabolic pathways
aasc01110  Biosynthesis of secondary metabolites
aasc01120  Microbial metabolism in diverse environments
aasc01130  Biosynthesis of antibiotics
aasc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aasc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A4S02_10310
Enzymes [BR:aasc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     A4S02_10310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AOW47879
UniProt: A0A1D8QZW9
Position
2131092..2132159
Genome map
AA seq 355 aa AA seqDB search
MSLPQTTTPPQQFGSDNYAGLCPQALEAISRAAKGSTPAYGDDAWTRLAAKAVADMFETP
DAAVFFVLTGTAANALTLATLCPPYCSIIASEVAHAETSERGAPEFFTGGAKLITPPTPD
GKLTPEAIKLAARRASSPRASAPAVVTITQPTENGLVYSIDEIRAIANACHDHGLRLHMD
GARFANAIATLGCTPAAMTWQSGVDALSFGGTKNGMAMGEAVVFFKRSMAQGFAERARQS
GQTASKMRFLSAPWLAMIHSGAWLDNARHANASARQFAQVVEDIPSVKLAWPVQSNAVFL
LMPEPVMNELRARGWRFYTFFGGICRFMFAWDARPEAIAALAADLRSCVRGQGAL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgccgcaaaccaccacgcccccgcaacagtttggcagtgataactatgccggc
ctgtgcccgcaggcgctggaagccataagccgcgcggccaaggggtctacccccgcatat
ggggatgacgcatggacgcgccttgcggccaaagccgtagcagatatgtttgaaacacct
gatgccgcagtgttttttgtactgacaggcaccgcagccaatgcgctcacactggcaaca
ttgtgcccaccttattgcagcattattgcctcggaagtggcgcatgccgaaacatccgaa
cgcggggcaccagagttttttaccggtggtgccaaactcataacgccccccactccagac
ggtaagctcacaccagaagccatcaaactggcagcccgccgcgccagcagcccgcgggct
tctgcccccgcagtggtgaccataacgcaacccacagaaaacgggcttgtgtattcaatt
gatgagattcgggccattgccaatgcctgccacgatcatggcttgcgactgcacatggat
ggcgcacgttttgccaacgccattgccacattgggctgcacaccagccgccatgacatgg
caatctggcgtagatgccttgagctttggtggcaccaaaaacggcatggccatgggggaa
gctgtggtgttttttaaacgcagcatggcccaaggttttgccgaacgcgccagacagagc
gggcaaacggcctctaaaatgcgttttctgtctgccccgtggttggccatgatccatagt
ggcgcatggctggataacgcgcgtcacgccaatgccagcgcacgccaatttgcacaggtg
gtagaggatattccctccgttaaactggcatggcccgtgcaatccaacgctgtatttttg
ctgatgcccgaacctgtcatgaacgaattgcgggcccgtggctggcgcttttacacgttt
tttgggggtatctgccgctttatgtttgcgtgggacgcacggccagaagccattgccgct
ctggcagcagatttacgtagctgcgtgcgcgggcaaggtgccttataa

DBGET integrated database retrieval system