KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_0689Help
Entry
D11S_0689         CDS       T00993                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
aat00010  Glycolysis / Gluconeogenesis
aat00020  Citrate cycle (TCA cycle)
aat00620  Pyruvate metabolism
aat01100  Metabolic pathways
aat01110  Biosynthesis of secondary metabolites
aat01120  Microbial metabolism in diverse environments
aat01130  Biosynthesis of antibiotics
aat01200  Carbon metabolism
Module
aat_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D11S_0689
   00020 Citrate cycle (TCA cycle)
    D11S_0689
   00620 Pyruvate metabolism
    D11S_0689
Enzymes [BR:aat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     D11S_0689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: ACX82091
Position
613776..615392
Genome map
AA seq 538 aa AA seqDB search
MTDVNNVVKELEAIGIHNVKEVVYNPSYEQLFEEETKPGLEGFEKGTVTTTGAVAVDTGI
FTGRSPKDKYIVLDDTTKDTVWWTSDAAKNDNKPMTQETWASLKDIVTKELSGKRLFVID
GFCGASEKDRIAVRIVTEVAWQAHFVKNMFIRPTDAELKDFKPSFVVMNGSKCTNPNWKE
QGLNSENFVAFNLTERIQLIGGTWYGGEMKKGMFSMMNYFLPLKGVGAMHCSANVGKDGD
VAVFFGLSGTGKTTLSTDPKRELIGDDEHGWDDVGIFNFEGGCYAKTIHLSEENEPDIYR
AIRRDALLENVVVRADGSVDFDDGSKTENTRVSYPIYHIDNIVKPVSRAGHATKVIFLTA
DAFGVLPPVSKLTPEQTKYYFLSGFTAKLAGTERGITEPTPTFSACFGAAFLTLHPTQYA
EVLVKRMQAAGAEAYLVNTGWNGTGKRISIKDTRGIIDAILDGSIEKAQMSELPIFNLAI
PKALPGVDPAILDPRDTYADKAQWEAKAKDLAGRFVKNFEKYATNAEGKALISAGPKA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgacagatgtaaacaacgtagttaaagagcttgaggcaattggcattcataatgtaaaa
gaagtggtttataacccaagttatgaacaactttttgaagaagaaaccaaaccgggcttg
gaaggtttcgaaaaaggcaccgtcaccaccaccggcgcggtcgctgtggataccggcatt
tttaccggacgttctcctaaggataaatatattgttttagatgacaccaccaaagacacc
gtatggtggacttccgacgcggcgaaaaacgataataaaccgatgacccaagaaacctgg
gcaagtttaaaagacatcgtcaccaaagaactttccggcaaacgcttattcgtgattgac
ggcttctgcggtgccagcgaaaaagaccgtattgcggtgcgtatcgtgactgaagtggca
tggcaggcgcatttcgtgaaaaatatgtttattcgtccgacagacgccgaattaaaagat
ttcaaaccaagtttcgtggtgatgaacggttctaaatgcaccaacccgaactggaaagaa
caaggcttgaattccgaaaacttcgtggcgtttaacttaaccgaacgcattcaattaatc
ggcggcacttggtacggcggtgaaatgaagaaaggtatgttctccatgatgaactacttc
ctgccgctaaaaggcgtgggcgcaatgcactgttccgctaacgtaggcaaagacggtgat
gttgctgtgttcttcggcttgtccggcaccggtaaaaccaccctttctaccgatccgaaa
cgtgagctaatcggtgatgatgaacacggttgggatgatgtgggtatcttcaactttgaa
ggtggttgttacgcgaaaaccattcacctttccgaagaaaacgaaccggatatttatcgc
gcaatccgtcgtgatgccttattagaaaacgtagtggtgcgtgcagacggttcagtggat
ttcgatgacggttccaaaaccgaaaacacccgcgtttcctatccgatttatcacatcgat
aacatcgttaaaccggtttcccgcgcaggtcacgctactaaagtgattttcttaaccgct
gacgctttcggcgtgttgccgccggtatctaaattgacaccggaacaaaccaaatactac
ttcttatccggtttcactgcgaaattagccggtactgaacgtggtattaccgaaccgacc
ccaaccttctccgcttgtttcggtgcggcgttcttaaccttacacccaacccaatatgcg
gaagtgttggtaaaacgtatgcaagcggcaggtgcggaagcctatttggtgaacaccggt
tggaacggcacgggcaaacgtatctccattaaagatacccggggtattatcgacgccatc
ttagacggttctatcgaaaaagcgcaaatgagtgagttaccaatcttcaatttggcaatt
cctaaggcattacccggcgttgatccggctattttagatccgcgtgatacttatgccgat
aaagcgcaatgggaagccaaagcgaaagatcttgccggtcgttttgtgaagaacttcgaa
aaatacgctaccaatgcagaaggcaaagccttaatttctgccggtcccaaagcgtaa

DBGET integrated database retrieval system