KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_1228Help
Entry
D11S_1228         CDS       T00993                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
aat00430  Taurine and hypotaurine metabolism
aat00620  Pyruvate metabolism
aat00640  Propanoate metabolism
aat00680  Methane metabolism
aat01100  Metabolic pathways
aat01120  Microbial metabolism in diverse environments
aat01200  Carbon metabolism
Module
aat_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:aat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    D11S_1228
   00640 Propanoate metabolism
    D11S_1228
  09102 Energy metabolism
   00680 Methane metabolism
    D11S_1228
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    D11S_1228
Enzymes [BR:aat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     D11S_1228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ACX82610
Position
complement(1146683..1147885)
Genome map
AA seq 400 aa AA seqDB search
MSEKLVLILNCGSSSLKFSILNPATGEEKLSGLAEAFYLPEARIKWKLHGEKGQADLGAG
AAHAEALNFIVNKIFSLDPELQKGVVAIGHRIVHGGEKFTSSVIVTDEVVKGIEEAIQFA
PLHNPAHLIGIREAFKLFPHLKDKNVVVFDTAFHQTMPEEAFLYALPYSLYREHGVRRYG
AHGTSHYYVSREAAKRLGVPEDKINVITCHLGNGGSVSAIRHGKCIDTSMGLTPLEGLVM
GTRSGDIDPAIIFYMHDTLGMSVKEINDTLTKKSGLLGLTEVTSDCRYAEDNYEKEIPAK
RALGVYCYRLAKYIGSYMAVIGERLDAIVFTGGIGENSAHVREITLDHLKLFGYKLDQEK
NLAARFGKEGIITADNTPIAIVIPTNEELVIAQDTARLCI
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaaattagtcctaattctcaattgtggtagttcctcattaaaattctcaatt
cttaatcctgcaacaggcgaagaaaaattatccggcttagccgaagcgttttatttacct
gaagcccgtattaaatggaaattgcacggtgaaaaagggcaggcagatttaggtgccggt
gccgctcacgccgaagcattaaatttcattgttaataaaattttctctcttgatcctgaa
ttacaaaaaggcgttgtagccatcggtcatcgtatcgtacacggcggcgaaaaattcact
tcttccgttattgtgaccgatgaagtggtcaaaggcattgaagaagcaattcaattcgca
ccgctgcacaacccggcacatttaatcgggatcagagaggctttcaaattattcccgcac
ctgaaagataaaaatgtcgtggtattcgataccgccttccatcaaaccatgccggaagaa
gcattcctatacgcattaccgtactctttataccgcgaacatggcgttcgtcgctacggt
gcgcatggtaccagccactattatgtcagccgtgaagcagcaaaacggttaggtgtgccg
gaagataaaatcaacgtgatcacttgtcatttaggtaacggcggttccgtatcggcaatc
cgtcacggcaaatgtatcgacacctcaatgggtttaacgccattggaaggtttagtgatg
ggtacccgttccggcgacatcgaccctgctattattttctatatgcacgatactttgggt
atgtccgtgaaagaaattaacgatacgttaactaagaaatccggtttattaggcttaacg
gaagtgaccagtgactgtcgttatgcagaagataattatgagaaagaaatcccggcaaaa
cgcgcattaggtgtctattgctatcgtttagccaaatacatcggctcttatatggcggta
atcggtgaacgtctggatgctatcgtgtttaccggcggtatcggtgaaaactccgcccat
gtgcgtgaaatcaccttggatcacttaaaattattcggttacaaactggatcaagagaaa
aatcttgccgcccgtttcggtaaagaaggtatcatcacggccgataacactcctatcgct
atagtaattccaaccaacgaagagctcgttatcgcacaagatactgcacgtctttgtatt
tga

DBGET integrated database retrieval system