KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_1374Help
Entry
D11S_1374         CDS       T00993                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
aat00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aat01100  Metabolic pathways
aat01110  Biosynthesis of secondary metabolites
aat01130  Biosynthesis of antibiotics
aat01230  Biosynthesis of amino acids
Module
aat_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aat00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    D11S_1374
Enzymes [BR:aat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     D11S_1374
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     D11S_1374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C HHH_4
Motif
Other DBs
NCBI-ProteinID: ACX82756
UniProt: C9R4M0
Position
1300106..1301536
Genome map
AA seq 476 aa AA seqDB search
MITQDFSKPLETATVLQKIVLDKAQWVKAKAAEFPLSALEKNIEKSDRTFYGALTQGSHE
KPAYILECKKASPSKGLIRSEFKPTEIAQVYKNYASVISVLTDEKYFQGDFAYIQQVRDV
VTQPVLCKDFMISEYQVYLARFHQADAILLMLSVVNDETYRILADLAHSLGMGVLTETSN
EEEFERALALGAKIIGVNNRNLHDLTVDLNRVVELTAKYADKIPEDVRIISESGIYNHQQ
VRELQRVAHGFLIGSSLMGSADLNNAVREVIFGENKVCGLTRAQDVKTVYDNGALYGGLI
FAEQSKRCVSLRQAQELVTAAPLRFVGVFQNQNIDFIVKIAQQLQLYAVQLHGNETPAFI
TALRAQLPQHIRIWKAISVDVKHKSAVNFDDVSEVDRFIFDSKSGTQQGGTGATFDWSLI
PQELKYKIILAGGISPSNIEDALAQHCAGVDLNSGVESAPGVKDAEKVRSVFAKIL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgatcacacaagacttctccaaaccactcgaaaccgccacagtgctacaaaaaatcgtt
ctcgacaaagctcaatgggtgaaagccaaagcggcggaatttccgttgagtgcccttgaa
aaaaacattgaaaaatccgaccgcactttttatggcgcgttgacgcaaggttcgcatgaa
aagccggcatatattctggaatgtaaaaaagcctcgccttccaaaggattgattcgcagt
gaatttaaaccgacagagattgcacaggtgtataaaaattacgcgagcgtgatttccgtg
ctaaccgatgaaaaatatttccaaggggattttgcctatattcagcaagttcgcgacgtt
gtcacgcaaccggtgttgtgcaaagactttatgatcagcgaatatcaggtttatttggca
cgttttcatcaagccgacgccattttactgatgctttccgtggtgaacgacgaaacctat
cgcattttggcggatttggcccattccctcggcatgggcgtgctgaccgaaaccagcaac
gaggaagaatttgaacgcgccttggcgttaggcgcaaaaattatcggcgtgaacaatcgt
aacctgcatgatttaacggtagatttaaatcgcgtggtggaactcaccgccaaatatgcg
gataaaatccctgaggatgtgcgaatcatcagcgaatcgggcatctataatcatcaacaa
gtgcgtgaattacaacgcgttgcccatggctttttaatcggcagcagcttaatgggcagc
gcggatttaaataacgccgtacgtgaagtgattttcggtgaaaacaaagtgtgtggctta
acccgtgcgcaggatgtgaaaaccgtttacgacaacggcgctttatatggtgggctaatt
ttcgccgaacagtctaaacgctgcgtcagtttacgtcaggcgcaggaattggtgaccgcc
gccccactgcgttttgtgggcgtgttccaaaatcagaacattgattttattgtgaaaatc
gcccaacagttacaactctacgccgttcagttgcacggaaacgaaacgccggcatttatc
accgcacttcgcgctcaattgcctcaacatattcgtatttggaaagccatttctgtagat
gtgaagcataaaagtgcggttaattttgacgacgtttccgaggtggatcgttttattttc
gacagcaaatcaggcacacaacaaggcggcacgggggcgacttttgattggtctctgatt
ccgcaggaattgaaatataaaattattctggcgggcggcattagcccgagtaatattgaa
gacgcattggcacaacattgtgcaggcgttgatctcaattccggcgtagaaagcgcccca
ggcgtgaaagatgccgaaaaagtgcggtcggtttttgcgaagattttgtaa

DBGET integrated database retrieval system