KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_1386Help
Entry
D11S_1386         CDS       T00993                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
aat00260  Glycine, serine and threonine metabolism
aat00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aat01100  Metabolic pathways
aat01110  Biosynthesis of secondary metabolites
aat01130  Biosynthesis of antibiotics
aat01230  Biosynthesis of amino acids
Module
aat_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aat00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    D11S_1386
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    D11S_1386
Enzymes [BR:aat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     D11S_1386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Mic1
Motif
Other DBs
NCBI-ProteinID: ACX82768
UniProt: C9R4N2
Position
1310823..1312016
Genome map
AA seq 397 aa AA seqDB search
MAETILNPYFGEFGGMYVPEILVPVLQQLEKAFVEAKADPAFQREFQDLLKNYAGRPTAL
TLCRNLTKGTNAKIYLKREDLLHGGAHKTNQVLGQILLAKRMSKTRIIAETGAGQHGVAT
ALACAMLDMPCRVYMGAKDVERQSPNVFRMRLMGTEVVPVQKGSCSLKDACCEAMRDWSA
NYENTHYLLGTAAGPHPFPTIVREFQKMIGEETKRQMLEKEGRLPDAVIAAVGGGSNAIG
MFTDFIDEKEVRLIGVEPAGKGIETGKHGAPLGHAKVGIYFGMKSPLMQTEDGQVEESYS
ISAGLDFPSVGPQHAYLQSIGRAEYPSITDNEALDAFQALAKHEGIIPALESSHALAQAL
KMIRQEPNKAQILVVNLSGRGDKDIFTVDKILNEKGM
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaacgattttaaacccgtatttcggggaattcggcggaatgtatgtgccggaa
attctagtgccggtgttgcaacagttggaaaaagcgtttgtagaagccaaggcggatcct
gcatttcagcgcgaatttcaggatttattgaaaaattatgccggcagacccaccgcactt
accctttgtcgcaatctcaccaaaggcaccaacgccaaaatctatttaaaacgggaagat
ttattacacggcggcgcacataaaaccaaccaggtattaggtcagattttgcttgccaaa
cgcatgagcaaaacccgcattattgccgaaaccggcgcgggacagcacggtgtcgccact
gctctcgcctgcgccatgttggatatgccgtgccgtgtttatatgggcgcgaaagatgtg
gaacgccaatcgccgaatgtgtttcgtatgcgtttaatgggcacggaagtggtaccggtg
caaaaaggttcctgttctttgaaagacgcttgctgcgaagccatgcgtgactggtcggca
aattatgaaaatacgcactatttgctcggcacagcggcaggtccgcacccttttccgact
atcgtgcgtgaattccagaaaatgatcggggaagaaaccaaacgccaaatgctggaaaaa
gaaggtcgtttaccggacgcggtaattgcggcagtcggcggtggctcaaatgcgatcgga
atgtttaccgattttattgacgaaaaagaggtgcgtttaatcggcgtggaacctgccggc
aaaggcattgaaacgggcaaacacggcgcgccgttaggtcatgccaaagtgggaatttat
ttcggtatgaaatcaccgttgatgcaaacggaagacggtcaagtggaagaatcctattcc
atttcggcgggcttggatttcccttccgtggggccgcaacacgcctatttacaaagcatc
ggtcgtgcggaatacccaagtattaccgataatgaagcccttgacgcgttccaagcattg
gcaaaacacgaaggcattattcctgcgttagaaagctcccacgccctcgcccaagcctta
aaaatgatccgtcaggaaccaaataaagcacaaattttggtggtgaatttgtccggtcgc
ggcgataaagatattttcaccgtagataaaattttaaatgaaaaaggaatgtaa

DBGET integrated database retrieval system