KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_1455Help
Entry
D11S_1455         CDS       T00993                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
aat00471  D-Glutamine and D-glutamate metabolism
aat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aat00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    D11S_1455
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aat01011]
    D11S_1455
Enzymes [BR:aat01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     D11S_1455
Peptidoglycan biosynthesis and degradation proteins [BR:aat01011]
 Precursor biosynthesis
  Racemase
   D11S_1455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ACX82831
Position
complement(1383186..1384013)
Genome map
AA seq 275 aa AA seqDB search
MDIQTKPTILFFDSGVGGFSVYHEVKQLLPDYHYLYCFDNAYFPYSEKPEEKIIERTLKI
CQRIDQMYPLDLIVIACNTASTVVLPSLREHFSIPIVGTVPAIKPAAAQTTTKHIGLLAT
KGTVNRKYLSDLIDKYAADCRVEKIGSTKLVELAERKFHGYPIDLNEIKSEVLTWVTMSD
LDCVVLGCTHFPLIKSEIQQCLPQVIYFIDSGAAVAKRVESLLSDVKVRSKNQTNNQVFC
TKMISPEDGLPNLIQSLGFETLRLLDVDSEVLREI
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggacattcaaacaaaacccacaattcttttttttgattccggcgtcggcggctttagt
gtttatcatgaggttaagcaacttttgcctgactatcactatttgtattgctttgataac
gcttactttccttattccgagaagcctgaagaaaagatcatcgaacgtacgttaaaaatc
tgccaacgcatagatcaaatgtatccgttggatcttattgtcatcgcctgtaatacggca
agcaccgttgtgttgccctcattgcgcgaacatttttcaattccgattgtaggcaccgtg
cccgcgattaaaccggcagcagcgcaaacaaccacgaaacatatcgggttactagccacc
aagggaacggtaaaccgaaaatatttatctgatttgattgataaatatgccgctgattgc
cgtgtggaaaaaattggcagtacgaagttggtagaattggctgaacgtaaatttcatggt
tatcctattgatttaaatgaaattaaatctgaagtgctaacgtgggttacaatgagtgat
ttagattgtgtggtgctgggatgtacgcatttccctctgataaaatcagagattcaacaa
tgtttgccgcaagtcatctattttattgattcgggtgctgccgttgcgaaacgggtggaa
tccttgcttagtgacgtaaaagtgcggtcaaaaaatcaaacaaataatcaagtgttttgc
acaaaaatgatctcaccggaagacggtttaccaaatttaattcagtctttaggatttgaa
acgctgcgtttattagatgtcgatagtgaggttttgagagaaatttga

DBGET integrated database retrieval system