KEGG   Paenarthrobacter aurescens: AAur_0174Help
Entry
AAur_0174         CDS       T00447                                 

Gene name
dhaK2
Definition
(GenBank) dihydroxyacetone kinase, L subunit
  KO
K05879  phosphoenolpyruvate---glycerone phosphotransferase subunit DhaL [EC:2.7.1.121]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00561  Glycerolipid metabolism
aau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aau00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    AAur_0174 (dhaK2)
Enzymes [BR:aau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.121  phosphoenolpyruvate---glycerone phosphotransferase
     AAur_0174 (dhaK2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dak2
Motif
Other DBs
NCBI-ProteinID: ABM07572
UniProt: A1R184
Position
181039..181701
Genome map
AA seq 220 aa AA seqDB search
MGLDVDWALDWLKLSAKAMAEHRVELIELDRPIGDSDHGENMDRGFQAVLQKLDETPPET
PGAALKAAAMALMSKVGGAAGPLYGTAYLRAATSLGDAGDIDAEALAAALAAARDGVVAR
GKAELGDKTMIDAWTPAVEAAQKAAASGADPVAVLEAAAEAAETGAMATDPLVARKGRAS
YLGERSAGHRDPGAASTALLLRAAAAAAAGSTADKGADAV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggggctggacgttgactgggcactggactggttgaagctctccgccaaagccatggcc
gaacaccgggtggagctgattgagctggacaggccaatcggcgattcggatcacggcgag
aacatggaccgcggtttccaggccgtgctgcagaaactagatgagaccccgccggagact
ccgggcgcggcgttgaaggctgcggcgatggcgctcatgtccaaggtgggcggcgctgcc
ggaccgctgtacggcacggcgtatcttcgggcggcaacctccttgggggacgccggcgat
attgacgcggaggcccttgccgcagccctggcagccgcccgtgatggagtagtggcccgg
ggcaaagccgagctcggcgacaagaccatgatcgacgcgtggacgcccgcggttgaagcg
gcccaaaaagccgcggcgagcggcgctgatccggttgctgtgttggaagcggctgcggag
gctgccgaaaccggcgccatggccacggatccgttggtggcacgcaagggccgggccagc
tacctgggggagcgcagtgcagggcatcgcgaccccggcgccgcttccaccgcgcttctc
ctgagagcggccgcagcagctgctgccggttccacggctgacaagggagccgacgccgta
tga

DBGET integrated database retrieval system