KEGG   Paenarthrobacter aurescens: AAur_0199Help
Entry
AAur_0199         CDS       T00447                                 

Definition
(GenBank) putative phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
aau  Paenarthrobacter aurescens
Brite
KEGG Orthology (KO) [BR:aau00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AAur_0199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ABM06556
UniProt: A1R1A9
Position
complement(206132..207148)
Genome map
AA seq 338 aa AA seqDB search
MTIAFLVLVVALASGFAFLNGFRDVSNAVALSTRTRALTPSIAVLLAAIFNFVGAMLSGT
FILAFTQSWITLPEGTSGLTMLASALTAAILWGVYAWWRGIPLSSTNSLIGGLIGAGAAS
VLVGGNAVGGMDNVLLTQVALPLVLSPVIAFVAAYLLVWPVTWAARYTQPNVVNRRFRRA
QAISTAAVAFGHGLQDGQRTAAVMVLAMVAAGLSSGSDVPLWILLVTAIMLTAGTMFGGW
RISHTLGHKLIRVDPLRGFVAQTLTSVMLFIGAIGFHLPLSTTHTLTAAVLGSGVNQRFH
TVNRRLVRRVLLFWVATPLITAAAAFILELAFSPLADL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcgccttcctggtcctcgtcgttgctttggcctccgggttcgcgttcctcaac
ggcttccgcgacgtctccaacgccgtcgcgctgtccacgcggacccgtgccctcacgccg
tcaatcgcggtgctcctggctgccatcttcaactttgtgggtgccatgctcagcggcacc
tttatcctcgccttcacgcaatcgtggatcacgttgccggagggcaccagtgggctcacc
atgctggcgtccgcgcttaccgccgccatcttgtggggcgtgtacgcgtggtggcgggga
attcccttatcctccacgaactcattgatcggcggcctcatcggcgccggggccgcgagt
gtccttgtgggcggcaacgctgtgggaggcatggacaatgtcctgctaacccaggttgcc
ctgcccctggtgctctcccccgtcatcgccttcgtggccgcatacctgctggtgtggcct
gtcacgtgggctgcccgctacacccaacccaacgtggtgaaccggcggttccggcgggca
caggccatctcgactgcggctgtggcattcggccacgggctccaggacggtcagcgcacg
gccgctgtcatggtgctggccatggtggccgcgggcctgtccagcggcagcgacgtgcct
ctgtggatcctactggtcaccgccatcatgctcactgcgggcaccatgttcggcggctgg
cgaatctcccacaccctcggccacaaacttattcgggtggatccgctgcgcggtttcgtg
gcgcagactctgacgtccgtaatgctcttcatcggcgccatcggatttcacctgccgctt
tccaccacccacacgttgaccgccgccgtgctgggttcgggcgtgaatcagcggttccac
accgtcaacaggcgcctggtcaggagggtgctgttgttctgggtggccacaccgttgatc
acggcagccgcggccttcatcctggagctggcgttctcgcccctcgcggacctgtaa

DBGET integrated database retrieval system