KEGG   Paenarthrobacter aurescens: AAur_0762Help
Entry
AAur_0762         CDS       T00447                                 

Definition
(GenBank) glycosyl transferase, group 2 family domain protein
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Glyco_trans_2_3 Glyco_transf_21 Glyco_tranf_2_2 Chitin_synth_2 Glyco_tranf_2_4
Motif
Other DBs
NCBI-ProteinID: ABM08993
UniProt: A1R2V1
Position
792441..793736
Genome map
AA seq 431 aa AA seqDB search
MTFPSVALVVVYVGGLVILGFGMAKIVYVPMALYFDWLYRSICARHRYSVLSDRPLVSVI
VPGYNEAVVITGCVESILASRYLRLEVILVDDGSTDETASIMEGLAQQYDRVRFLSQANA
GKGAALNCGIAAALGDILMFVDADGVFAPDTLIHMLEGFDDPKVGAVCGDDRPVNLDRLQ
TMMLAILSHVGTGLVRRALSLMNCLPIVSGNIGAFRSDLVRELGGFHEDTLGEDLELTWR
VYKAGYRVRFQPKALVYAESPSTMGGLWRQRVRWSRGLLQTLRLHSGMLGSRRYGMFGAF
LVFNAITMVLIPILQLVVLALLPFLYVAGMGPVPAEVLAILGWLGVFVSLALIVFSVGLN
RSWRDLRFLWTLPLWPFYSVFVGLALASAIVKEIRGSPARWNKLQRTGIKSVTATHSVTS
TDVSQRQEAHA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgacgttcccgagcgtggcgttggtggtggtgtacgttggcggtttggtgattctcggt
tttggcatggccaaaatcgtctatgttcccatggcgttgtatttcgactggctttaccgc
tccatctgtgcccggcatcggtattccgtgttgagcgataggcctttggtgtcggtgatt
gtcccgggctacaacgaggccgtggtgatcaccggctgtgttgagtccattttggccagc
cggtacttgcgcctggaagtcattctggtggatgacggttccacggatgagaccgcctcc
atcatggaaggcttggcgcagcagtatgaccgggtgcggttcctttcgcaggccaacgcg
ggcaagggcgccgctttgaattgtgggattgcagcagccctcggggacattctgatgttt
gtggacgccgatggagtctttgctccagacacgttgatacacatgctggagggttttgac
gatccgaaagtgggcgcagtgtgcggcgatgaccggccggtcaacctcgatcgcctgcag
accatgatgcttgcgatcctgagccacgtgggtacgggattggtccgtagggctctatcc
ctcatgaattgcctgcccatcgtttccggaaacattggcgcctttcgcagcgatttggtc
cgggagctgggagggttccacgaggacacgctcggggaagaccttgagctgacatggcgg
gtctacaaagccggataccgggttcgattccagcccaaagcactcgtgtacgccgagtct
ccctccaccatgggtggcttgtggcgtcagcgggtccgctggtcgcgagggctgctccag
acgctgaggttgcacagcggaatgctcgggagccgccgctacggaatgttcggggcgttc
ctggttttcaacgccatcaccatggtgttgatccctattctgcaactcgtcgtcctggct
ctactaccgttcctgtacgtggcaggcatgggacccgtcccagctgaagtcctcgcaatc
ctcggctggctcggggtctttgtgtcattggcgctgatcgtcttctccgttggcctgaac
cgctcatggcgggatctgcgattcctgtggacgctgccactgtggcccttttactcggtg
tttgtgggcttggccctggccagcgcaatcgtgaaagaaatccgtggcagtccggcccgt
tggaacaagctgcagcggacaggcatcaagtctgtgactgccacgcattctgtgacctcc
actgatgtgtcacaacggcaggaagcgcacgcgtga

DBGET integrated database retrieval system