KEGG   Paenarthrobacter aurescens: AAur_0771Help
Entry
AAur_0771         CDS       T00447                                 

Definition
(GenBank) hypothetical protein
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABM06550
UniProt: A1R2W0
Position
802042..802734
Genome map
AA seq 230 aa AA seqDB search
MTDNRKFEIVADTELPGTPERVWQAVTKDTPAWMFPTDQWPDVKTTEEYPSHLVSRMDGP
DGWFNQLEHVLEPLEGGRAKLHYVHSGIFADNWDEQYDGASKHTEFYLHTLGQYLQHFDG
KPVVFTDIQAPPSSQAPDGFVQLKQALGVDGLPTGTSVDVDIDGVGRLSAEVDFSNENFL
GLRTADTMYRFFGRNVFGAPVGMTVHEFSGSGDSELTAKAWGAFLEKVYA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaaccgtaaattcgaaatcgtggcggacaccgaactgcccggcaccccggag
cgtgtgtggcaggcggtcaccaaggacacgccggcttggatgttccccacggatcagtgg
ccggacgtcaagaccactgaggagtaccccagccacctggtgtcccggatggatggtccg
gacggatggttcaaccagctggagcacgtccttgagccccttgaaggtggccgtgccaag
ctgcactacgtccacagcgggatcttcgccgacaactgggatgagcagtacgacggtgcc
agcaagcacacagagttctacctccacacccttggccaatacctgcagcacttcgacggc
aagccggtggtgttcacggatattcaggcgcccccttcatcacaggcgcctgacggtttc
gtgcagctgaagcaagcgttgggtgtggacgggctgcccaccggtacttccgtggacgta
gatatcgacggcgtcggacggcttagcgccgaggtggacttctccaacgagaacttcctg
ggcctccgaaccgcggacaccatgtaccggttcttcggccgcaacgtgttcggtgctccg
gttggcatgacggtgcacgagttcagtggctcgggcgattcggaactcacggccaaggct
tggggcgcgttcttggagaaggtgtacgcgtag

DBGET integrated database retrieval system