KEGG   Paenarthrobacter aurescens: AAur_0773Help
Entry
AAur_0773         CDS       T00447                                 

Definition
(GenBank) transcriptional regulator, GntR family
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 GntR Aminotran_MocR HTH_Crp_2 HTH_24 MarR_2 HTH_11 HTH_36
Motif
Other DBs
NCBI-ProteinID: ABM09930
UniProt: A1R2W2
Position
complement(803928..805391)
Genome map
AA seq 487 aa AA seqDB search
MSGSLNPTALVRLLGSWNSGALPAYRELADVVRLLVMDGRIPLDVALPSERALAQTLGLS
RTTVTAAYASLREQGFLTAGQGSRGRTCIPHRTAPVSAPGLAVPEGLLDLAYASLPAAGE
VVHRAFADALTELPALLPGFGYEAVGVQALREAIADKYTAEGVPTTPGQILVTSGAQHAL
NIVLRTLAGKQDRVMVEHPSYPNALDAIRAAGCKPLPVALPLIQSSTSPAWDIDAMVATM
NHQRPAVAYLVPDFHNPTGRIMSDLQRRRLTRAATASGTILVVDETLRGLNLDGVRTAPM
SAYSPAVVSIGSLSKSHWAGLRTGWVRADEALIARFVSTRTVMDLGGPVVEQLAAARLVR
SFAEPLDARLEELRNNRETLLGLLSEHLPEWDVERPRGGLTVWCRLPTPCSTALTMLAPD
FGVRLAAGPRFGVGGAFEHYLRVPYTLPAAQLEFAVGALRAAQNKLDASPHLRRTLKSAR
PPAVAVA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgtccggctccctgaatcccaccgcactcgtccgcctcctcggctcctggaactccggc
gccctgcccgcctaccgcgagctggccgacgtcgtgcgtttgctggtgatggacgggcgc
ataccgctggacgtcgcactgcccagcgagcgggcgctcgcccagacactcggcctcagc
cgcaccacggtcactgccgcgtatgcgagcctgcgcgaacagggattcctgacggcgggc
cagggcagccgcgggcggacgtgcatcccccaccgaaccgcgccagtgagtgcgcccgga
cttgccgttcctgagggtctcttggacctggcgtatgcgtcgctgccggccgccggcgag
gtagtgcatcgggccttcgccgacgccctgaccgagttacctgccctcctgcccggattc
gggtacgaggccgtgggagtgcaggccctccgggaagccatcgcagacaaatacacggcg
gaaggggtgccaacgacgcccggccaaatcctggtcacctcgggtgcgcagcatgcactc
aacatcgtgctgcgcacgctggctggaaagcaggaccgggtgatggtggaacaccccagc
taccccaatgccttggacgccatccgtgctgcagggtgcaagccgctgcccgtagcacta
cctctaatacagtcgagtacgtcaccggcgtgggacatagatgccatggtggcgaccatg
aatcatcaacgtcccgccgtggcctacttggtgccggacttccacaaccccaccgggcgc
atcatgtccgatcttcaacgccgacgactcacacgggcagccaccgcttccgggaccata
ctggtggtggatgaaacgctgcgggggctgaacctcgacggcgtccgcaccgcgccgatg
tcggcttacagtccggcggttgtttccatcggctcgctcagcaagtcgcactgggccggg
ctgaggaccgggtgggtccgggcagacgaggccctgattgcccgctttgtctctacccgg
accgtcatggatctgggtgggcccgtggtggagcaactggcggcggcacgcctggtgcgg
tccttcgcagagccgcttgatgcccggcttgaggagcttcggaacaaccgggaaacgctg
ctggggttgctttcggagcacctgccggagtgggacgtggagcgaccccgcggcggactc
acagtgtggtgtcgccttcccacgccgtgcagcactgccctgaccatgctcgcgcccgac
ttcggcgtacgcttggcggccggacctaggtttggggtgggtggcgctttcgagcattac
ctacgcgttccctacaccttgccggctgcacagttggagttcgccgtcggtgcgctccgc
gccgcgcagaacaagttggacgcctcaccccacctccgccggacgctcaagtccgcacgg
ccacccgccgtcgcggttgcctag

DBGET integrated database retrieval system