KEGG   Paenarthrobacter aurescens: AAur_0775Help
Entry
AAur_0775         CDS       T00447                                 

Definition
(GenBank) putative integral membrane protein
  KO
K07149  uncharacterized protein
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YitT_membrane
Motif
Other DBs
NCBI-ProteinID: ABM06311
UniProt: A1R2W3
Position
805452..806081
Genome map
AA seq 209 aa AA seqDB search
MMTRRITQLLIGLAMYGISLAMFIRAGLGLDPWDVFHQGVSEKTGFSIGVVVIAVSFLVL
LLWIPLRQMPGIGTIANAVLVGLFADLGLWLIPEFSHLGGQIAMLAGAVILNGIASACYI
GARLGPGARDGLMTGLVRRTGWSVRLVRTGIEVVVLAVGFLLGGSVGVGTVVYALAIGPI
VQVLLPKFMVPERAKATAPTEAVEAAPAA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatgacccgaagaatcacacaactcctgatcggcctcgcaatgtacggcatctccttg
gccatgttcatccgggccggcctcggcttggacccttgggatgttttccaccaaggtgtg
tccgaaaagaccggattcagcattggcgttgtggtcatcgcggtcagcttcctggttctc
ctcctctggatcccgctccggcagatgccagggatcggaaccatcgccaacgcggtcctc
gtggggctcttcgccgatcttgggctctggctcatcccggagttctcacaccttggcgga
cagatcgccatgctcgccggcgctgtgatcctcaacggcatcgcctccgcttgctacatc
ggtgcccgccttgggcccggcgcccgtgatggcctgatgaccggactggtccgacgcacc
ggttggtccgtgcggctggtccgcacgggcatcgaagtagttgtccttgctgtgggtttc
ctgctgggcggatccgtgggcgtgggcaccgtggtgtacgccctggccatcggcccgatt
gtgcaagtgctgctgccgaagttcatggttccggagcgggcaaaggcaacggcccccacg
gaagccgtggaggccgcgcctgcagcgtag

DBGET integrated database retrieval system