KEGG   Paenarthrobacter aurescens: AAur_0776Help
Entry
AAur_0776         CDS       T00447                                 

Definition
(GenBank) conserved hypothetical protein
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_26 DUF4874 EF-hand_5
Motif
Other DBs
NCBI-ProteinID: ABM07020
UniProt: A1R2W4
Position
complement(806099..807319)
Genome map
AA seq 406 aa AA seqDB search
MAQTPPAFIGHPNRKRRRASLLIPLVVTALAATCLGFASKEVVPVVQALSLCRAGDASTL
IPRDGVLLGVNLDWDSETLAEHRANLGHDPAVVVQFSDIPYDDETWSHTTNAVTQVRETG
GALLLTLEPHGGLETMSDEVIAKLATDLRAINDQGTTVVVRFAHEMNGSWYSWGQQPIRY
VDVFRKVAAAVHSQAPGTSMMWAPNYGGGYPFTGGQFAARPGTPDFAALDTDHDGTLTMA
DDTYAPYYPGDDAVDWVGVSLYHWGNQRPWGNNDVSEPGKFLAMLTGSYSGTAGDDSSVP
DFYQVYGVDHGKPVGIPETAAIYTPARGGASELDVKQAWWRQVFSAETHQKYPQLKMINW
FEWKKYEIEINDDVDWRSAGSPAIRDALAQDLPDWLRYGEDLEACR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagactcctccagctttcatcgggcatccgaaccgaaaacgacggcgggccagc
ctgctcatccccttggtggtgacggccttggctgccacgtgtttgggttttgcttccaag
gaggtggtgcccgtggtccaggccttgtccctttgccgggccggtgatgcctccaccctg
atcccccgggatggcgtgctcttgggcgtcaacctggattgggactcggagaccttggcc
gaacaccgagcaaacctcggccacgatcccgcggtggtggtgcagttctcggatatcccc
tacgacgacgaaacgtggtcgcacaccaccaacgccgtcacgcaagttcgggaaacgggc
ggcgcgctgctcctgaccctcgagccccacggcggtttagagaccatgagcgacgaagtg
atcgccaaactggccaccgacttacgggccatcaacgatcaggggaccaccgtcgtcgtg
cgttttgcgcatgagatgaacggctcctggtactcgtggggacagcagccgatccgctac
gtggacgttttccgcaaggtggcggcggcggtgcactcgcaggctccggggacgtccatg
atgtgggcgccaaactatggcggcggctatccgttcacgggtggccagttcgctgcgcgg
ccaggcaccccggacttcgctgccctggataccgatcacgacggcaccctcaccatggcc
gacgacacctacgcgccctactatccgggggacgacgccgtggactgggtgggggtttcc
ttgtatcactggggcaaccagcggccatggggcaacaacgacgtttcggaaccgggcaaa
ttcctggccatgctcaccggcagctacagcggcaccgcgggtgatgacagttccgtcccc
gatttttaccaggtgtacggggtggaccacggcaagccggtgggcattccggagaccgcg
gccatctacacgcccgcgcggggcggggcctccgagctggacgtcaagcaggcctggtgg
aggcaggtcttctccgccgaaacccaccagaagtacccgcagctgaaaatgatcaactgg
ttcgagtggaagaaatacgagatcgagattaacgacgacgtcgactggcgtagcgctgga
tcgcccgctatccgcgatgcgctggcccaggacctgccggactggttgcggtacggcgag
gacctggaggcgtgccgttag

DBGET integrated database retrieval system