KEGG   Paenarthrobacter aurescens: AAur_0778Help
Entry
AAur_0778         CDS       T00447                                 

Definition
(GenBank) glycosyl transferase, group 2 family domain protein
  KO
K00694  cellulose synthase (UDP-forming) [EC:2.4.1.12]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00500  Starch and sucrose metabolism
aau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AAur_0778
Enzymes [BR:aau01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.12  cellulose synthase (UDP-forming)
     AAur_0778
Glycosyltransferases [BR:aau01003]
 Polysaccharide
  Structural polysaccharide
   AAur_0778
Transporters [BR:aau02000]
 Other Transporters
  Others
   AAur_0778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Cellulose_synt Glyco_tranf_2_3 Glyco_trans_2_3 Glyco_transf_21
Motif
Other DBs
NCBI-ProteinID: ABM08202
UniProt: A1R2W6
Position
complement(807811..809754)
Genome map
AA seq 647 aa AA seqDB search
MLTRLGLFPSSYRRLKMGIYRQILVRILAVLVVSFGLIYISWRWSSTVAWDAWWISLPLV
AAETYSLGESALYAVTMWNARRRPPPPPALPGRSVDVFIATYNEPLDLVLKTAIAARDME
YPHETWILDDGDRAEFASAARQIGVGYITRGPEWDGRQRFAKAGNVNNALSMTTGEFVAI
FDADQVPEPRFLDRVLGYFDAEEVAFVQTPQHFWNVPDRDPLGSQAELFYGPIQQGKDGW
DAAFFCGSNAVLRREALMALGLTRYTRTATEQTWRALRRGRSRLQDLHSESGRRHPAAMP
VVESALEAVARAEHQVRRGEVLAEITFELRVAFHAAALAVPDAMDDVVPELDAVLESVDV
AHTDQALAIHPMDTTTITEDMATAMHLHAMGWGSIYHHEVLVHGLAPEDVSTMLSQRHRW
AAGTMQVFFNDNPLFLRGLTLAQRLMYLGTMTSYLNGFAALSYIAAPVVFLVAGTYPLTA
SPVVFFCLFLPFFISCQLLFQVAGNGSKGLWRGQQWSFALFPTWIAATCSGAAAVFLGRH
LTFSVTAKSKQATGRGFQHVRLQVAAMGLLVVSSLIGVARVSSGEAPLYPTLITLAWVAL
DLALLSVVIGAARYRGPGEDLVEPMPPPKELTSVLASPKGSPSKPLH
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgcgccttggccttttccccagcagttaccggaggctaaagatgggcatttac
agacaaatactggtaaggatccttgcagttctggtggtttccttcggattgatctacatc
agttggcgctggtcgagcaccgtcgcctgggacgcctggtggatttcgctgcccctggtg
gccgcggagacctacagcctgggcgaatcggcgctgtatgcggtcaccatgtggaacgca
cgacgacggccgcctcccccgcctgccctgccgggcagatcggtggacgtattcatcgcc
acctacaacgagccgctggacctggtactcaaaacggccatagcggccagggacatggag
tacccccacgaaacgtggatactcgacgacggcgaccgcgccgagtttgcgagcgcagcc
cggcagatcggcgtcggatacatcacccgcggtcctgagtgggatggccggcaacggttc
gcgaaagcaggaaacgtcaacaacgccctgtccatgaccaccggcgagttcgtggccatt
tttgacgcggaccaggttcctgaaccgcgtttcctggaccgcgttctgggctatttcgat
gccgaggaagtggctttcgtccagacgccgcaacacttttggaacgttccggaccgggac
ccgttgggaagccaagcggaacttttctatggcccgatccagcagggcaaggacgggtgg
gacgcagcgttcttctgcggttcgaacgctgtgcttcgcagggaagccctcatggctctt
ggtttgacccgctacacgcggacagccacggagcagacgtggcgtgctttgcgcaggggt
cggtcgcggctgcaggaccttcacagcgaatcgggcaggcgccatcccgccgccatgccc
gtggtggaaagtgctttggaggcggtggcgcgtgctgagcaccaagtccgcaggggcgaa
gtcctggccgagatcactttcgagctccgtgtggccttccatgccgccgctttggcagtc
ccggatgcgatggatgacgttgtgccggaactggacgccgtcctggaatccgtggatgtt
gcacatacggaccaggctttggcgatccaccccatggataccaccaccatcaccgaggac
atggcaacggccatgcacctccacgcgatgggatggggcagcatctaccaccacgaggtc
ctggtccatgggcttgccccggaggacgtgtccaccatgctctcgcagcggcatcgctgg
gcggcgggcaccatgcaggtgtttttcaacgacaatcctctgttccttcggggtctgacg
ttggcccagcgcctcatgtacctgggcaccatgacgagctacttgaatggcttcgccgcg
ctgagctacatcgcagcgccggtggttttcctggtggccggtacctacccgctgactgcc
agtcctgtggtgttcttctgcctttttcttcccttcttcatttcgtgccagctgctcttc
caagttgcaggtaacgggtcgaaggggctgtggcgaggccagcagtggtccttcgcgctg
tttcccacctggatcgcggccacgtgttcaggtgcggccgcggtcttcctgggcaggcac
ctcaccttctccgtgacagccaagagtaagcaagccacaggacgcggattccagcacgtc
aggctccaagtggcggcgatggggttgctcgttgtgtcctcgctcatcggcgttgcccgg
gtgtcatccggggaagcgccgctctatccaaccctgatcacgctggcctgggtcgccttg
gacctggccctgctcagcgtggtgattggtgccgcaaggtaccgggggccgggagaggac
ctcgtggaaccgatgcccccacctaaggagctcaccagcgtccttgcttcgccgaaaggt
tcgccaagcaaacccctgcactga

DBGET integrated database retrieval system