KEGG   Paenarthrobacter aurescens: AAur_0781Help
Entry
AAur_0781         CDS       T00447                                 

Definition
(GenBank) putative ATP dependent DNA helicase
  KO
K03724  ATP-dependent helicase Lhr and Lhr-like helicase [EC:3.6.4.-]
Organism
aau  Paenarthrobacter aurescens
Brite
Enzymes [BR:aau01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     AAur_0781
DNA repair and recombination proteins [BR:aau03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   DNA helicases
    AAur_0781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD_assoc DEAD Helicase_C HTH_42 ResIII AAA_25 AAA_22 MarR_2 PhoH
Motif
Other DBs
NCBI-ProteinID: ABM09446
UniProt: A1R2W9
Position
complement(812314..817260)
Genome map
AA seq 1648 aa AA seqDB search
MQEPKASDGAISRFSQATREWFLGAFSEPTPAQDGAWNAISSGSHALVVAPTGSGKTLAA
FLWALDRLHSKPTDTLPGLETVPANGKGRAKRPKTKTRVLYISPLKALGVDVERNLRAPL
IGITQTAKRLGLPAPLVTVGVRSGDTTAADRRTLLTNPPDILITTPESLFLMLTSRARET
LSEVDTIIIDEVHAVAGTKRGAHLAVSLERLDALLPKPAQRIGLSATVQPRELVAQFLAG
QAPVEIVAPPSKKNWNLTVTVPVEDMSDLQGAAGAFDSGPASGLQPQASIWPHVEEQIVD
LVLSKQSTIVFANSRRLAERLTARLNEIYAERQLMAVGGSEWAAPGAAPQSNPGIPASTA
TPAHMMAQAGSSTGADPVLARAHHGSVSKDQRAMIEDDLKSGRLRCVVATSSLELGIDMG
AVDLVVQVESPPSVASGLQRVGRAGHQVGEISEGVLFPKHRADLLHTSVTVERMLSGQIE
RLSIPANPLDILAQQTVAATALGSIDVEDWFSTVRRSAPFASLPRSAFEATLDLLAGRYP
SDEFAELRPRIIWDRHAGTIEGRPGAQRLAVTSGGTIPDRGLFGVYIIGTEVEGSASPAN
ADGSEPTASARAAKGGRRVGELDEEMVYESRVGDVFALGATSWKIEDITHDRVLVSPAFG
QPGKLPFWKGDSLGRPVDLGRALGAFIRELSAADEAPAMERCQASGLDAFAASNLIQYLR
EQKEATEIVPSDRTLVVERFHDELGDWRVVLHSPFGMPVHAPWALAVGQRLQQRYGLDGS
AMAADDGIVLRVPMMEDEPPGAELFLFDPEELEQIVTAEVGGSALFASRFRECAARALLL
PRQNPAKRQPLWQQRQRSAQLLDVARKYPSFPIVLETVRECLQDVYDLPALKDIAASVER
RELRIVETTTQQPSPFAKSLLFGYVAQFLYEGDSPLAERRAAALALDSTLLNELLGRVEL
RELLDAAVIDSTELELQRLAPDRRVRGMEGVADLLRLLGPLSVEEVAQRLQGVEQAEVEG
ADHFDEAPAAAPHGSVVDAGSHLAALQKANRALKVTIGGVERFAAVEDAARLRDAIGVPL
PMGVPLAFIEPVHDPLGDLVSRYARTHGPFTAAEAAARLGLGVAVVNTALKRLAGDGRVV
EGEFRPHAVAEQPAEAPDAELMTIDAPPSSEWCDAEVLRKLRRRSLAALRAEVEPVDTAA
YGRFLPAWQNVTAPGKSRSQALRGLDGIITAVDQLSGVPIPASAWEPLVLASRVADYKPA
MLDELMAAGELLWSGAGSLPGNDGWISLHVADSAELTLNPDPEFEPGDAQQRLLEHFSAG
GGYFFRQLTDVAGGMDAVLSDDAVVSALWDLVWAGRVTGDTFAPVRAMIAGGKTAHRQVA
KAPRARAPRMSRLGRSHGTGLLGSPGLTGGRYGSVSGGIAPAPPSAVGRWSALPAPELDP
TIHARGTAELLLDRYGVVTRGSVMAENIIGGFGLMYKVLARLEEAGRCRRGYFIEHLGAA
QFAVPATVDRLRSFTEDARISKAEPAALALAATDPANPYGAALPWPALSVDAGSGHRPGR
KAGALVVMVDGALVLYVERGGKTLLTFSQDDAVLTVAAQALVDVVRRGAVDKLFMEKVNG
HDLLDTPIAVALAAAGAYSTPKGLRIRA
NT seq 4947 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagccgaaggcgtcggatggcgctatcagccgtttcagccaggcaaccagggaa
tggttcctcggcgctttttccgagcccacacccgcgcaggatggtgcatggaacgcgatc
tcctcgggctcccatgccctggtagtggcgccaacaggttccggcaaaacccttgcggcg
ttcctgtgggcgctcgatcgcctgcattccaagcccactgacacgctgccaggtcttgag
actgtcccagccaatggcaagggtcgggcaaagcggcctaaaaccaagacccgcgtcctc
tacatctcgccgctgaaggcgctgggtgtggatgtggagcggaacctccgcgcacccctg
atcggcatcacccaaactgccaagcggttgggactccccgcaccactggtgacagtcggc
gtacgttcaggagatacgacggcggcggatcgccgcacgctgttgaccaacccgccggat
atcctcatcacaacgccggaatccctgttcctcatgctgacctcccgtgcccgggaaacg
ctcagcgaagtggacaccatcatcatcgatgaagtgcacgctgtagccggcaccaaacgt
ggcgcacacttggccgtttctttggaacgcctggatgccctgcttccgaagcctgcgcag
cgcatcgggctctcggcaaccgttcagccgcgtgagctggtggcgcagttcctggccggc
caagcccccgtggagatcgtcgctccaccatccaagaagaactggaacctcacggtcacc
gtacctgtggaggacatgtccgatctgcagggcgctgccggagcattcgactccgggccg
gcgtcggggttgcagccacaggcgtccatctggccgcacgtggaggagcagattgtggac
ttggtcttgtccaaacaatccaccatcgtgttcgccaactcccgtcgcttggcagaacgc
ctgacagcccgcctcaacgagatctacgccgagcgccagttgatggcggtaggcggcagc
gagtgggctgctcccggggcggccccccaatccaacccgggaatcccggcctccacggca
acccctgcgcacatgatggcgcaggccggaagctctactggcgccgatcccgtgcttgcg
cgcgcgcaccacggatcggtctccaaagaccagcgggccatgatcgaggacgacctcaag
tccggccggctccgctgcgtggtggcaacgtcatcactggaactcggcatcgatatgggt
gccgtggacttggtggtccaggtggagtctcccccatcggtggccagtggcctccagcgt
gtcgggcgtgcagggcaccaagtgggtgagatctccgagggcgtgctcttccccaagcac
cgcgcggacctcctccacaccagcgtcacggtggaacgcatgctgagtgggcagattgag
cgcctgagcatcccagccaacccgttggacatcctggcccagcaaacggtcgcagcaacc
gccttgggcagcatagacgttgaggactggttcagtacggtgcggcggtctgcgcctttc
gcgagcctgccgcgctctgcatttgaggccacgctggaccttctcgccggccggtacccc
tcagacgaattcgccgagctcaggccgcgcattatctgggaccggcatgccggaaccatc
gagggcaggcccggagcccagcgccttgccgtcacgtccggtggcaccatccctgaccgt
ggactcttcggcgtgtatatcatcggcacggaagttgagggctcagcttcccccgccaac
gcggacggatcagaacccaccgcttcggcgcgtgccgccaagggtggacgccgcgttggt
gagctcgacgaagagatggtgtacgaatcccgggtgggagacgtcttcgcgctcggtgcc
accagttggaagatcgaggacatcacccacgaccgcgtgctggtctcccccgctttcggc
caacccggcaagcttcccttctggaagggcgattccctcggcaggcccgtagacctgggc
cgcgcgctgggtgccttcatccgtgaactctcggccgcagacgaagccccggccatggaa
cgttgccaggccagcggattggatgccttcgccgcaagcaacctgatccagtacctcagg
gagcaaaaggaagccacggagattgtcccgagcgaccgaaccttggtggtggagcgcttc
cacgacgaactcggcgattggcgggtagtcctccacagtcctttcggcatgcccgttcac
gccccgtgggctcttgcagtaggccaacgccttcaacagcgctacggcctcgatggatcc
gctatggcagcagacgacggcatcgtgctgcgcgtgcccatgatggaagatgagccgccc
ggcgctgagctctttctcttcgacccggaggaactcgagcaaatcgtcaccgcagaagta
ggcggcagcgcactgttcgcttcccggttccgcgaatgtgccgcccgtgcattgcttctt
ccacgacagaatccggccaagcgtcagccgctatggcagcaacgccagcgctctgcccag
ttgctggatgtcgcccggaagtatccttcgttccccatcgtgctcgaaacagtgcgggaa
tgcttgcaggatgtttatgatctgcccgccctgaaagacattgccgcttctgtggagcgc
agggagctcaggatcgtggagaccaccactcagcaaccctcccctttcgcgaagtccctg
ttgttcgggtacgtggcccagttcctctacgagggcgactcccccttggccgaacgccgg
gccgctgccctcgccttggactccacgctcctcaatgagctcctgggccgcgtggaactg
cgcgagctcctggatgccgcggttatcgactcaactgagttggagctgcagcgcctcgcc
ccggaccgacgcgttcgaggaatggaaggcgtcgcggatctgctgcggctgctgggcccc
ctgagcgttgaagaagtggcccagcggctccaaggcgtggaacaagccgaagttgaaggc
gcggaccacttcgacgaagccccggcggctgcgccacatggcagcgtcgtcgacgccgga
tcccaccttgcggcattgcagaaagccaaccgcgcactcaaggtaaccatcggcggcgtc
gagcgctttgccgcagttgaggacgcggcgcggctgcgtgacgcaatcggtgttccgttg
cccatgggcgtaccgcttgctttcattgagccagtccacgatcccctgggcgacctcgtt
tcccggtacgcgcgcacccatggccccttcactgccgctgaagctgcggcgcggctgggg
cttggcgtcgcggtagtcaacaccgccttgaaacggttggctggcgacggtcgcgtggtg
gaaggcgaattccgtccgcacgccgtcgcggagcagcctgcggaagcacccgacgcagag
cttatgaccattgacgccccaccgtccagcgagtggtgcgatgccgaagtcctccggaaa
ctgcggcgtcgctcgctcgctgcgctgcgggccgaagtggagccagtggacaccgccgcc
tacggccggttcctgcctgcctggcagaacgtgaccgcgccgggcaagtctcgaagccag
gcattgcgggggttggacggcatcatcacagccgtggaccaactatccggagtacccatc
ccggcatccgcgtgggaacccctggtactcgcgagcagggtggcggactacaagccggcc
atgctggacgaactcatggcggccggcgagctcctctggtccggcgcaggctcgctgccc
ggaaacgatggctggatcagcctgcacgtagccgattccgctgagctgacgctcaacccc
gaccccgagttcgaacccggcgatgcccaacagcgtctcttggaacatttcagtgcgggc
ggtggctacttcttccggcaactcacggacgttgccggcggcatggatgcagtcttgagc
gacgacgccgtggtctccgcgctctgggacctcgtctgggccggccgcgtaacgggcgat
acctttgcacccgtgagagccatgatcgccggagggaaaaccgcgcaccggcaagtagcc
aaggcgcccagggcccgggccccgcgcatgagcaggctcggccgttcccatgggacgggc
ctgctcggctcccccggactaacggggggtcgctacggctcggtatcaggcggaattgcg
cctgcaccgccgtcggcagtgggtcgatggtccgctcttcccgccccggaactggacccg
accatccacgcacgcggcacggctgagctcctgttggaccgctacggcgtggtaactcgc
ggttcggtcatggcagagaacatcatcggcggtttcgggctcatgtacaaagtgctggcc
cgcttggaagaagccgggcgttgccgccgcggttacttcatcgagcatttgggggcagcc
cagttcgccgtccccgccacggtggaccggctcaggtccttcacggaggatgcccgcatt
tccaaggccgaaccagccgcccttgcactcgccgcgaccgaccccgccaacccctacggc
gctgcccttccttggcccgcgctgtctgtcgacgccggttccggtcaccgtccggggcgc
aaggccggagcgctggtggtgatggttgacggcgcgttggtcctctacgtggaacgcggc
ggcaagacgctgctcaccttcagccaggacgacgccgtgctgacagttgcggcccaagcg
ttggtggacgtggtgcgccgcggtgccgtggacaagctcttcatggagaaagtcaacggc
cacgatctcctggacactccgatcgccgttgccctcgcggcagcgggggcgtactccact
ccgaagggactccgtatccgtgcctga

DBGET integrated database retrieval system