KEGG   Paenarthrobacter aurescens: AAur_0782Help
Entry
AAur_0782         CDS       T00447                                 

Definition
(GenBank) conserved hypothetical protein
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4232 Med13_C
Motif
Other DBs
NCBI-ProteinID: ABM07159
UniProt: A1R2X0
Position
complement(817316..818017)
Genome map
AA seq 233 aa AA seqDB search
MAELTRIRAGARLVPMWTQRIKTGLVTTTAAAALLLLAACGPSPSPSGTSSAPPTSSTPT
SSTPSASATSSPPSATATATPSPSATATSAAPAAPGLCKAASLTAATDATGGGAAGSIYE
KLILTNSGSAPCILEGFAGVSLTADANGEPIGEPATRETTTPVTKIELAPGKSAWAEIRY
TQAGNYGDCTKVAAAGFRIYPPNDTASLFIPEPHDACSNAGIKLLTITAFQAV
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaattgactcggatcagggccggggcaaggctggtgcccatgtggactcagcgc
atcaaaaccggacttgtgacgacgacggcagccgctgcgctgctccttcttgctgcctgc
gggccaagccccagcccgtcgggaaccagcagtgccccgccaacttcttcgacgccaact
tcctcgactccgtcggcctcggcgacgtcaagcccgccttctgcgacggccacggccacg
ccgtcaccctcagcgacagcaacgtccgcggcaccagcagcaccggggctgtgcaaagca
gcgtccctcaccgctgcaaccgatgcgaccggaggcggcgcggcgggcagcatctatgag
aagttgatcctgaccaactccggcagcgccccctgcatcttggagggcttcgcaggagtc
tccttgactgccgacgccaacggtgaaccgatcggcgaaccggcaacccgggaaaccaca
accccggtcaccaaaatcgaactggctccggggaagtcggcgtgggccgaaatccggtac
acgcaagccggcaactacggcgactgcaccaaggtggccgccgccggtttccgcatctac
ccgccgaacgacacggcctcattgttcatcccggagccccacgatgcgtgcagcaacgcc
ggcatcaagctcctgaccatcaccgctttccaggcagtctga

DBGET integrated database retrieval system