KEGG   Paenarthrobacter aurescens: AAur_0790Help
Entry
AAur_0790         CDS       T00447                                 

Definition
(GenBank) putative 6-pyruvoyl tetrahydropterin synthase
  KO
K01737  6-pyruvoyltetrahydropterin/6-carboxytetrahydropterin synthase [EC:4.2.3.12 4.1.2.50]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00790  Folate biosynthesis
aau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AAur_0790
Enzymes [BR:aau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.50  6-carboxytetrahydropterin synthase
     AAur_0790
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.12  6-pyruvoyltetrahydropterin synthase
     AAur_0790
Transfer RNA biogenesis [BR:aau03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    AAur_0790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTPS
Motif
Other DBs
NCBI-ProteinID: ABM08044
UniProt: A1R2X7
Position
824073..824471
Genome map
AA seq 132 aa AA seqDB search
MFSLTVRRHFMIAHSLPREAFGPAQGLHGATFVAEVTFRRPNVNDDAIVLDIGAAGGILE
EVLADLNYKNLDEHPAFKGKLSTTEALAKHIADAMAARIQDTADGPALTGIDVVLRENPD
AWAGYSLELPVK
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgttcagcttgaccgtccgacgccacttcatgatcgcccacagccttccccgcgaagct
ttcggcccggcccagggcctgcacggcgccacgttcgtagccgaggtcaccttccgccgg
cccaacgtcaacgacgacgccatagtccttgacatcggtgccgccggcggcatcctcgag
gaagtgctcgccgacctgaactacaagaacctggacgaacaccccgctttcaagggcaaa
ctctccaccaccgaagcgctcgcgaagcacatcgccgacgccatggcggcccgaatccag
gacactgcggacggtccggccctgaccggcatcgacgtggtcctccgcgaaaacccggac
gcctgggcaggctactcgctggagctcccggtcaagtaa

DBGET integrated database retrieval system