KEGG   Paenarthrobacter aurescens: AAur_0791Help
Entry
AAur_0791         CDS       T00447                                 

Definition
(GenBank) putative glycosyl transferase, group 1 family protein
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: ABM06820
UniProt: A1R2X8
Position
824657..825475
Genome map
AA seq 272 aa AA seqDB search
MLDGATTVIADGLVASGAPDEIAGAAGKGTRVWILSHMALADHPDLEAKALAAATGIICP
SAHAAAELRARHGHQDIVVATPGAVEADPAKGSQPQHIVAVAALLPNKSQLELVEALSHT
QDLPWTAALIGSNDADPRYAAEVRAAVEHHGLQNRISVTGELTGEALEDQWHRADLSVLI
SRSESYGMAVSESLAHGIPVLVRKGTGAVEALGKTGAGTALELPETGNLTNTLRSWLTDP
ALQDRWRTAALKARDHLQGWGTTAAIVLKALT
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacggcgccacaacagtgattgccgacggcttggtggcgagtggggcaccggac
gagatcgccggtgccgcaggtaaaggaacacgggtctggatcctgtcccacatggcgttg
gcggaccatccggatcttgaggccaaggcgctggctgcggcgaccgggatcatttgcccg
agcgcccatgccgccgcggaactgcgagccaggcacgggcaccaggacattgtcgtggcc
acacccggggctgttgaagcagaccctgccaagggatcgcaaccgcagcacatcgtggct
gtcgcggcgttgttgcctaacaagagccaactcgaactcgtggaggccctcagccacacg
caggatctcccctggaccgcagccctcatcggctcaaatgacgctgacccgaggtacgcc
gcggaggtgagggccgccgtcgagcatcacgggctccaaaaccgtatcagcgtcaccggt
gagctgaccggcgaggccctcgaggatcagtggcacagggcggacctcagtgtccttatt
tcacgctccgaaagctatggaatggcggtctcggagtcgttggctcatggcatccccgtg
cttgtgcggaagggaacgggagcagtggaagcactgggtaagacaggggcgggcactgcc
ttggaactcccagaaaccgggaacctcaccaacaccctccgtagctggctcactgacccc
gcgctccaagaccgttggcggaccgccgccctcaaagcccgggaccatctccaaggctgg
ggcaccaccgcggccatcgttctcaaagccctcacgtag

DBGET integrated database retrieval system