KEGG   Paenarthrobacter aurescens: AAur_0793Help
Entry
AAur_0793         CDS       T00447                                 

Definition
(GenBank) putative glyoxalase family protein
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase Glyoxalase_2
Motif
Other DBs
NCBI-ProteinID: ABM06608
UniProt: A1R2Y0
Position
complement(826766..827146)
Genome map
AA seq 126 aa AA seqDB search
MSVSFNHTIVYAKDKHRSAEFLARILGLPKPQPMWSFVTVALENGVALDFLEASGEIAPQ
HYAFLVSEEEFDQIFLRITAEHIPYWADPARSREQQINHNDGGRGMYFCDPDGHFLEAIT
RPYGSG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtctctttcaaccacaccatcgtctacgccaaggacaagcaccgttcggcggag
ttcctggcccgcatcttggggcttccgaagccgcagcccatgtggtccttcgtgaccgtg
gcgttggagaacggcgtagcgctggacttccttgaggcctccggggagatcgccccgcag
cactacgccttcctggtcagcgaggaggagttcgatcagatcttcctgaggatcaccgcg
gaacacatcccctattgggccgatcctgcccgttcccgcgaacaacagatcaaccacaac
gacggcggccgtgggatgtacttctgcgaccctgacgggcacttccttgaggcgatcacc
aggccgtatggctcgggctga

DBGET integrated database retrieval system