KEGG   Paenarthrobacter aurescens: AAur_0799Help
Entry
AAur_0799         CDS       T00447                                 

Definition
(GenBank) putative amino acid decarboxylase, pyridoxal-dependent protein
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ABM09514
UniProt: A1R2Y6
Position
830785..832176
Genome map
AA seq 463 aa AA seqDB search
MSAMPEAYSAALKRAMVHATDWLASVPDRPVRPAVDADQVAASLASILPDGPTEAADVVD
ELATLAEPGLMAIQSGRFYGWVMGGTLPAAMAADWLVSAWDQNTGLRFATPAAAAIEESA
AAWLLDLLHLPATSDVGFTTGATTANFVGLAAGRQYLMDQAGWDLQSLGLSGAPRITTFA
GRERHAAVDLALRYLGLGACVPVDADEQGRILPEALAAAMDEQPGPSLVCLQAGNLHSGA
FDPMAEAVAVAHERGAWVHVDGAFGLWAAVSPTLRERLAGVEGADSWATDAHKTLNVPYD
CGLAIVASPEALRRAFSIHTSYFIATDAGPGDPFEKVPELSRRARGIPVWAALRQLGRHG
VIAMVERLAANARALAEGLAAIPGVEVLNDVVFTQVSVSFGSDDRTHRVTQRLMAEGAVW
MSGSAWRGREILRISVSNWSTDAGDVAASIAAVRRAVEAEPEA
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgatgccggaggcgtacagtgctgcattgaagcgggccatggtgcacgcaacg
gactggttggcgtcggttcccgaccgccccgtccgtcccgcggtcgacgccgatcaggtg
gccgcgagcttggcatcgatcctcccggacgggccaactgaagccgctgatgtggtggac
gagcttgccaccctggccgaaccgggcttgatggccatccagtccggacggttctacggg
tgggtcatgggtggaaccctgcccgccgccatggccgccgactggctggtttcggcatgg
gaccagaacactggactccgcttcgccactccggctgcggctgccatcgaagaatccgcc
gccgcctggcttcttgacctcctgcacctgcccgcaacctccgacgtcggcttcaccacc
ggtgccaccaccgcgaacttcgtgggactggccgctggccgccaatacctgatggatcag
gctggctgggatcttcagtcgctgggcctctcgggtgctccacgcatcaccaccttcgcg
ggacgggagcggcacgcggccgttgacctggcgctccggtatctcgggttgggggcctgc
gttccagtggacgctgatgagcagggtcgcattctgcccgaggcactggcggctgccatg
gatgagcaacccgggccatcgttggtctgcctgcaagcgggtaacctgcactccggcgcc
tttgaccccatggcggaagctgtagccgttgcccatgaacgcggggcatgggtgcacgtg
gatggtgcttttggtttgtgggcggccgtcagcccaacgttgcgggaacggctggctggt
gttgagggcgccgactcctgggctaccgatgcacacaaaacactcaatgttccctacgac
tgcggcttggcgatcgttgcgagcccggaagcacttcgccgggcgttcagcatccacacg
agctacttcatcgcaacggacgccggaccgggggaccctttcgagaaggttcccgagttg
tcgcgccgcgcccgcggcattcccgtgtgggccgccctcaggcagttgggccgccatgga
gtgatcgccatggttgaacggcttgcggcgaacgcccgtgcgttggctgagggcctcgcg
gcaatcccgggcgtcgaggtcctcaatgatgtcgtctttacgcaggtctcggtgagcttc
ggcagcgacgaccgcacgcaccgcgtcacgcaacggctcatggccgagggcgcggtgtgg
atgtcgggctcggcctggcgcggccgggagatcctgcggatctcggtcagcaactggtcc
acggacgcgggggatgttgcagcgtccatcgcagcggtccggcgtgcggtggaggccgaa
ccggaggcgtag

DBGET integrated database retrieval system