KEGG   Paenarthrobacter aurescens: AAur_0800Help
Entry
AAur_0800         CDS       T00447                                 

Definition
(GenBank) putative dolichyl-phosphate beta-glucosyltransferase
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_4
Motif
Other DBs
NCBI-ProteinID: ABM08241
UniProt: A1R2Y7
Position
complement(832180..833199)
Genome map
AA seq 339 aa AA seqDB search
MPTGHPALLQGQTGPSPQPRRLPVDTSVVVPVLDLTVPVYNEEARLEHNLRQLHGHLTRS
FPHTFRITVADNASTDSTLRIAERLARELPELTVVRFQERGRGNALRQVWQSSPSPVLAY
MEADLSTDLSALAPLVAPLISGHSDLAIGTRLAPGSRVTRSPHREFISRSYTSLLRTVLG
ARFSDAQCGFKAVRADVAHRLLPHTTDDSWFFDTELLVIAERCGLRVHEVPVDWTDDADS
RVDVVRTALADLRGMARLNRNLRRIPIHELRRELGVKATLRGSLSRRVFRALTWTLAYAV
VFLLIRNATDPWMASVVALLLTTWVTRPFRRYVMRGSNF
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
ttgcccactggtcacccggctctcctccaaggccagacgggtccgagcccccagccccgg
cgtctccccgttgacaccagtgttgtggttcccgtcctggacctcaccgtccctgtctac
aacgaggaagcgcgcctggaacacaacctccgccagctgcacgggcatctgacgaggtcc
tttccgcacacgttccggatcaccgtggcggacaacgccagcacagacagcacgctgagg
attgccgagcgtcttgcccgtgaactccctgaattgacggtggtccggttccaagagagg
ggacgcgggaacgctctccgccaggtctggcagtcgtcgccgtcacctgtgcttgcctac
atggaagcggatctgtccacggacctctccgcgctggcgccccttgtggcaccgctgatc
tccggccactcggacctcgccatcggcacgcgtctggcgccgggttcccgtgtcacccgc
agtccgcatcgtgagttcatttcgcgcagctacacctcgctccttcggacggtcttgggg
gctcgtttctccgacgcccagtgcggcttcaaggccgtccgcgccgacgtagcgcaccgc
ctcctcccccacaccacggacgactcgtggttcttcgataccgaacttctggtgatcgct
gaacgctgtggtctgcgcgtccatgaagtacccgtcgactggaccgacgacgctgactcc
cgtgtcgacgtcgtacgaaccgccctggccgacctgcgcggtatggcgcgcctgaaccga
aacctgcgccgcattccgatccacgagcttcggcgtgaactgggagtgaaagcgacgttg
aggggcagtctgtcccggcgcgtgttccgggccttgacgtggaccttggcctacgctgtg
gtcttccttctaatccgcaacgccacggacccttggatggcgagcgtcgtggcgttgctg
ctcaccacttgggtaacgcgcccgttccggcgttacgtgatgcggggaagcaacttctga

DBGET integrated database retrieval system