KEGG   Paenarthrobacter aurescens: AAur_0808Help
Entry
AAur_0808         CDS       T00447                                 

Definition
(GenBank) putative integral membrane DUF6 domain protein
  KO
K15268  O-acetylserine/cysteine efflux transporter
Organism
aau  Paenarthrobacter aurescens
Brite
Transporters [BR:aau02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   AAur_0808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA
Motif
Other DBs
NCBI-ProteinID: ABM07104
UniProt: A1R2Z5
Position
840629..841618
Genome map
AA seq 329 aa AA seqDB search
MKQIYAVPCRIQRWCFNQKKARVLLVNLRHSALAVLVAVLWGINFVAIDLGLHTNGREVP
PLLFVAMRFLLVVFPFILFIRKPDVGWKAILGVGLFMSAGQFGLLYLGMALGMPAGLASL
VLQAQVLFTILLAAKFLGERPSRRQLAGVALGIAGLAVVAWGRSAVAPVLPLMIVLAAAL
SWAIGNVVARHTKAASGLGLVVWSGAVVPVPLAGLSLLVDGPGAVWSTIIDLQPATILSA
IYTAVFASLIGYGIWNRLLSLYPSSDVVPFTLLVPVVGMTAAWLVLNEIPTLTEILGGLI
LLLGVATAVLGAGRKIRPETPVVRPALRL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaatctacgctgtcccatgtcgaattcaacgctggtgcttcaaccaaaagaag
gccagagtgttacttgtgaaccttcgccactctgccctagccgtcttagtcgctgtcctg
tggggcatcaacttcgtcgcgatcgacctcggcctgcacaccaacggcagggaggtcccg
ccgctgctcttcgtcgccatgcgcttcttgctggtggtctttcccttcatcctgttcatc
cgcaaaccagacgtcggctggaaggcgattctcggcgtcgggctcttcatgagtgccggc
caattcggcctcctgtacctgggcatggccttggggatgcccgcaggtttggcctccctg
gtccttcaggcgcaagtgttgttcaccatcttgctcgcggcgaagtttctcggagagcgg
ccgagccgccgccaactggcaggcgtggcactgggcatcgcgggcttggcagtggtggca
tgggggcgcagtgccgtggcgccggtgctgccgctcatgatcgttctggccgcggcgttg
tcctgggcgatcggcaacgtggtggcccggcacacgaaagcggcttccggcttgggcctg
gtggtgtggtccggtgccgtggtgccggtcccgttggctggcctctcactgttggtggat
gggccgggcgccgtgtggtcaaccatcatcgacctgcagccggccaccatcctgagcgca
atctacacggctgtgttcgcgtccctgatcggctacggcatctggaaccgtttattgtcg
ctgtatccgagttccgacgtcgtgccgttcacgcttcttgtccctgtggtggggatgacg
gccgcgtggcttgtcttgaacgagattcccacgctgaccgagatcctgggcggattgatc
ctgctcctgggagttgccaccgccgtcctcggagccggacgcaaaatccgcccggaaact
cccgttgtgaggcccgctctgcgcctctaa

DBGET integrated database retrieval system