KEGG   Paenarthrobacter aurescens: AAur_0819Help
Entry
AAur_0819         CDS       T00447                                 

Definition
(GenBank) putative ABC-2 type transporter
  KO
K01421  putative membrane protein
Organism
aau  Paenarthrobacter aurescens
Brite
KEGG Orthology (KO) [BR:aau00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    AAur_0819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_3 DUF3533 ABC2_membrane DUF2680 HAUS-augmin3
Motif
Other DBs
NCBI-ProteinID: ABM09503
UniProt: A1R305
Position
complement(854077..856113)
Genome map
AA seq 678 aa AA seqDB search
MTVLRLARSELKRMTGGLLPKLTILALTMVPLLYGAVYLYANWDPYGNLNQIDAALVVED
TGATSKDGTELQAGKKVADSLVDGHVFNWKQVSSAEDADAGVRTGEYAFALRIPKDFSAN
LVSPGSFDAANQAMLHVTTNDANNYLLSTIVDKLTTAVHSTVAKEVGEETANQLLTGFGT
IHASIVKAADGASELATGVGKLSDGAATLHDGTTQLVTGADQLVAGQTQLRDGAVQLNTG
ASQLSSGLTELRNKTATLPTDSQKLADGAAQVAAGNAELNTKVQDVVGQLEAADKGLRTR
VLESNARLVSAGVLTQEQADKVLADFDAAAASSPVTDAKAKIAGDAAKIQQLSDGSAAVS
AGASKLAAATPALTDAISKAADGAGQLNAGASTLAAGQQTALDGAAKLDDGAHQLDNGAG
QLASGAVTASDGSHTLATELAKGAGDIPNPNDEQKSSVSKVIADPVAVDNVSQAKAGSYG
AGLAPFFLTLALWIGVFMLVQAMRPITQRALASNAPAWKIAVGGWLPFFVVSVLQATILT
LVVNLGLGLNPAHPIGMWLFMLAAVMAFSAIIQGIVALMGTPGKFVVLILLVLQLVSSGG
TFPWQTTPMPLHVVHEVLPMGYVVTGMRHLIYGGELSMIWPTVLGLLGYTLLGMALSTLA
VRKHKVWTLKTLKPEIAV
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
gtgactgttctgcggctggcccgctccgaactcaagcgcatgaccggcgggctcctgccc
aagctgaccatcctcgccctcaccatggttccgttgctctacggcgcggtgtacctttac
gcgaactgggatccgtacggcaacctgaaccagatcgacgccgccttggtggtagaagac
acgggtgccacctcaaaagacggcacggaactgcaggccggcaagaaggtggcagacagc
ctggtggacggtcacgtcttcaactggaagcaggtctccagcgctgaggatgcggatgcc
ggtgtccgcacgggtgagtacgctttcgccctgcgcatacccaaggatttctcggccaac
ctggtctcacccggcagtttcgacgccgccaaccaggccatgctgcacgtcaccaccaac
gatgccaataactaccttctgagcaccatcgtggacaagctcaccacggctgtgcactcc
actgtcgccaaggaagtgggcgaggaaaccgccaaccagctcctcaccggcttcggcacc
atccacgcgtccatcgtgaaggccgctgatggcgcctcggagttggccacgggtgtgggg
aaacttagtgatggcgccgcgaccctgcacgacggcaccacgcaactggtcaccggcgca
gaccaactcgtcgcggggcagacccagttgcgcgatggcgctgtgcagctgaacaccggc
gccagccagctcagttccggcctcacagagctcagaaacaagaccgctacccttccaacg
gactcccaaaagctcgctgatggcgccgcccaagtagccgccgggaacgccgagctgaac
acgaaagtccaggacgtcgtcgggcagctcgaagcggcagacaagggcctccgtacccgt
gtgctcgagtcaaacgcccggctggttagtgccggtgtgctgacgcaggagcaggccgac
aaggtcctggcagactttgatgctgccgcagcgtcgagcccggtcaccgatgcgaaggca
aaaattgccggtgacgctgccaaaatccagcagctctccgacggttcagccgctgtgagc
gccggagcctccaagctggccgccgccacgccagcgctgaccgacgccatctcgaaggcc
gccgacggggccgggcagctcaacgcgggcgcatcaacgttggccgccgggcagcagacc
gccttggacggcgcagccaaactcgacgacggtgcgcaccaactggacaatggcgcaggc
cagctcgccagcggcgcagtgaccgcgtccgacggttcacataccctggccactgagctc
gccaaaggcgcgggagacatccccaacccgaacgacgagcagaagagcagcgtgtccaag
gtgatcgcggatcccgtcgccgtggacaacgtctcccaagccaaggcgggctcctatggc
gccgggctggcacccttcttcctgacgctcgccctgtggatcggcgtgttcatgctggtc
caggccatgcgacccatcacccaacgggccctggcatcgaacgcccccgcctggaaaatc
gccgtcggaggctggctgccgttcttcgtggtctcggtcctgcaggccaccatcctcacc
ttggtagtgaaccttggcctcggcttgaaccccgcacatcccatcggaatgtggctgttc
atgttggccgcggtgatggcattcagcgcgatcatccaaggcatcgtggcgctgatgggg
acgcccggaaagttcgtggtgctgatcctgttggtcctgcagctcgtttcctcgggcggt
acgttcccgtggcagaccacgcccatgccgctgcacgtggtgcacgaggtcctgcccatg
ggatacgtggtgaccggcatgcgtcacctgatctacggtggtgagctcagcatgatctgg
cccacggtccttggcctgcttggatacactttgctgggaatggcgctgtccacgctcgcc
gtccgcaaacacaaggtgtggaccctcaagaccctgaagccggagatcgcagtatga

DBGET integrated database retrieval system