KEGG   Paenarthrobacter aurescens: AAur_0821Help
Entry
AAur_0821         CDS       T00447                                 

Definition
(GenBank) pyridine nucleotide-disulphide oxidoreductase domain protein
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00010  Glycolysis / Gluconeogenesis
aau00020  Citrate cycle (TCA cycle)
aau00260  Glycine, serine and threonine metabolism
aau00280  Valine, leucine and isoleucine degradation
aau00620  Pyruvate metabolism
aau00630  Glyoxylate and dicarboxylate metabolism
aau00640  Propanoate metabolism
aau01100  Metabolic pathways
aau01110  Biosynthesis of secondary metabolites
aau01120  Microbial metabolism in diverse environments
aau01130  Biosynthesis of antibiotics
aau01200  Carbon metabolism
Module
aau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aau_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAur_0821
   00020 Citrate cycle (TCA cycle)
    AAur_0821
   00620 Pyruvate metabolism
    AAur_0821
   00630 Glyoxylate and dicarboxylate metabolism
    AAur_0821
   00640 Propanoate metabolism
    AAur_0821
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AAur_0821
   00280 Valine, leucine and isoleucine degradation
    AAur_0821
Enzymes [BR:aau01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     AAur_0821
Exosome [BR:aau04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AAur_0821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 HI0933_like GIDA Lycopene_cycl K_oxygenase NAD_binding_7 DAO NAD_binding_9 Shikimate_DH AlaDh_PNT_C 3HCDH_N Amino_oxidase Thi4
Motif
Other DBs
NCBI-ProteinID: ABM08334
UniProt: A1R307
Position
complement(856982..858439)
Genome map
AA seq 485 aa AA seqDB search
MTAESSREFDVIVIGAGAVGENVADRVVRGGLTAVIIESELVGGECSYWACIPSKALLRP
GSVLHAAQVVPGAKEAITGTMDAEAALKHRDWFTNNWQDGSQVEWLDSAGIELIRGRGRI
TGPREVQVDGLDGNNYALKAHHAVVVATGSTPTIPDIDGLKDVPFWTTRGATAAKEIPKR
FVVLGGGVAGVELAQAFARFGSDVTLIARGRLLSSYTEEAANLVLAGLRADGVAVHLHTD
VEKVEKNDDGSLTVTFDDKTITADKLLVASGRHPALVNLGLENVGVEAQDGKPLRLTTDA
SGLVEGPASDGTSGLWLYAAGDAAGKVLLTHQGKYEARATGDAIVARANGKLTGTPKPWS
PWAHTANDHAIPSVVFTDPEVASVGASLEQALLQGKNVTGVELPIDVSGSQLHSPDYKGW
AQIVVDEDRKVILGATFVGPGVAELLHSATIAIVGEVPLDRLWHAVPSYPTVSEVWLRLL
EKYGL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgagagctcccgggaattcgacgtaatcgtgatcggcgctggcgccgtggga
gaaaacgtggcggaccgggtggttcgcggcggcctgacggcggtgattatcgagagcgag
ttggtgggcggcgagtgctcctactgggcgtgcattccttccaaggcgctgcttcgtccg
ggcagcgtgcttcacgccgcgcaagtggtgcccggcgccaaagaggcgatcactggaacc
atggatgccgaggccgcactgaagcaccgggactggttcaccaataattggcaggacggc
agccaggttgaatggctggacagcgccgggatcgagttgatccgaggacgtggccgcatc
acagggcctcgcgaggtccaggtggatggactcgacggcaacaattacgctctgaaagct
caccatgccgtggtggtcgcgacgggttcaacccccaccatcccggacattgacggtttg
aaggacgtacctttctggactacccgcggcgccacggcagccaaggaaattccgaagcgc
tttgtggtccttggcggcggggtggcgggtgtggaattggcgcaagcattcgcccggttc
ggctcggatgtcacgctcatcgcccgtggccgcttgctgagcagctacacggaggaagcc
gcgaacctggtgctggccgggcttcgcgccgacggtgtggctgttcatcttcacactgat
gtggagaaagtggagaagaacgacgacggctcattgacagttacgttcgacgacaaaaca
atcacagccgataaactcctggtcgcctccggacggcaccccgccctggtcaatctgggc
ttggaaaacgtgggcgttgaagcacaggacggcaaacccctccgactcacaacggatgcc
agcggcctggtggaaggccctgccagtgacggcaccagcggactgtggctctacgccgcg
ggggatgcagccggcaaggtgctcctgacgcatcagggcaagtacgaggccagagcaacc
ggtgacgcaattgtggccagggccaacggcaaactcaccgggacacccaaaccgtggagc
ccgtgggcccacacggccaacgatcacgccatccccagcgtcgtcttcaccgatcccgag
gtggcatctgtaggcgcgagcctggaacaggcactgctgcagggcaagaacgtcacgggc
gttgagctccccatcgacgtgtccggttcccagctgcactccccggactacaaggggtgg
gcgcagatcgtggttgacgaggaccggaaggtcatcctcggagctactttcgtgggtccg
ggcgtggccgagctactgcactccgcgaccatcgccattgtgggtgaggttcccttggat
cggctctggcatgcagttccgtcgtatcccaccgtcagcgaagtgtggctgcggcttctg
gagaagtacggcctctaa

DBGET integrated database retrieval system