KEGG   Paenarthrobacter aurescens: AAur_0822Help
Entry
AAur_0822         CDS       T00447                                 

Definition
(GenBank) putative thiosulfate sulfurtransferase
  KO
K01011  thiosulfate/3-mercaptopyruvate sulfurtransferase [EC:2.8.1.1 2.8.1.2]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00270  Cysteine and methionine metabolism
aau00920  Sulfur metabolism
aau01100  Metabolic pathways
aau01120  Microbial metabolism in diverse environments
aau04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:aau00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AAur_0822
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AAur_0822
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    AAur_0822
Enzymes [BR:aau01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.1  thiosulfate sulfurtransferase
     AAur_0822
    2.8.1.2  3-mercaptopyruvate sulfurtransferase
     AAur_0822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhodanese Abhydrolase_3
Motif
Other DBs
NCBI-ProteinID: ABM08878
UniProt: A1R308
Position
858595..859416
Genome map
AA seq 273 aa AA seqDB search
MGDELKPFVDWNWCARNLGTVVFVDARWYLDGSSGKDAYDAGHLPDAVFVDMDRWLSGPA
TPEAGRNPLPEPEVFAQGMREAGIGDSDTVVAYDDAGGVIAARLVWMLRSTGHTAAILDG
GIGNYPGDLSTETPLRRTGSFTAKAWPADLLADISEASSDTFLAVDARNRDRFEGRQDPI
DPRPGHIPGAANVPCRENLDSTGNLLPEPQIRTNFERAGVLSAEGTIAYCGSGVTACHNL
LVMEQLGMGSGRLFVGGWSQYSRANDRPVETKI
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgggagatgaactgaagccttttgttgactggaattggtgtgcccgcaacctcgggacc
gtcgtcttcgtggacgcgcgctggtacttggacggatcttcggggaaggacgcctacgac
gccggacatctcccggacgcagtgttcgtggatatggatcgttggctgtccgggcccgct
acacccgaagccggcaggaacccgctacccgagccggaagtgtttgcccaggggatgcgt
gaagccggtattggtgattcggacaccgtagtggcctatgacgacgccgggggagtcatc
gcggcccggctggtctggatgctccgatcgacgggacacactgcggcgatcctggatggg
ggcattggcaactatcccggggatctctccacggaaacaccgctacgccggaccgggagc
ttcaccgccaaagcctggcctgcagacctgctggcagacatttcggaagcttcctctgac
accttcctcgcagtggatgcgaggaatcgggaccgtttcgaaggccgccaagaccccatc
gacccccgccccggacacatacccggcgccgcgaacgtcccgtgccgtgagaacctcgat
tccacgggaaacttgctcccggagccgcaaattcgcacgaacttcgagcgcgccggagtc
ctgtccgcagaggggactattgcctactgcggatccggagtgactgcgtgccacaacctg
ttggtgatggagcagttgggaatgggctccggccggttgttcgttggcggatggtcccag
tactcccgcgcgaacgacaggccagtggagacgaaaatctag

DBGET integrated database retrieval system