KEGG   Paenarthrobacter aurescens: AAur_0823Help
Entry
AAur_0823         CDS       T00447                                 

Definition
(GenBank) putative N-acetylmannosamine-6-phosphate epimerase
  KO
K01788  N-acylglucosamine-6-phosphate 2-epimerase [EC:5.1.3.9]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:aau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AAur_0823
Enzymes [BR:aau01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.9  N-acylglucosamine-6-phosphate 2-epimerase
     AAur_0823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NanE His_biosynth NMO ThiG TMP-TENI IMPDH FMN_dh G3P_antiterm
Motif
Other DBs
NCBI-ProteinID: ABM08141
UniProt: A1R309
Position
complement(859484..860170)
Genome map
AA seq 228 aa AA seqDB search
MILTPKGLEALRSQLIVSCQAYPGEPMRDPRTTAQVAASAVIGGAAAIRVQGLADVQFTR
AAVELPVIGLWKDGHDGVFITPTLRHALAVANAGAHVVAIDGTRRSRPDGLSLSETVAGI
HADSHALVMADCGSFDDAVAAVEAGADLIGTTLAGYTGERPKTDGPDLELLEHIASAGLD
KPLIAEGRIHTPAHARQALDAGAFAVVVGTAITHPASITGWFKGAMHA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcacgcccaaaggcctcgaagccctccgttcccagctgatcgtctcttgccag
gcgtaccccggagagcccatgcgtgatccccggaccactgcccaagtagcggcatccgcc
gtcatcgggggcgctgcggcgatccgcgtccaggggttggccgacgtgcagttcactcgt
gccgccgtcgagcttcctgtcattggcctctggaaggacgggcacgacggcgtcttcatc
acccccacccttcgtcacgccttggcggtggcgaatgcgggtgcgcatgttgtggccatt
gacgggacgcggcgttcccgcccggatgggctttcgctttctgagaccgtcgcgggaatt
cacgcggattcgcatgcactggtcatggccgattgtgggtccttcgatgacgcagtggct
gcggtcgaagcgggtgcggacctgattgggacgacgttggccggttacacgggcgagcgc
cccaagaccgacggcccggacctggaactcttggagcacatcgcttccgccggcctggac
aagccactcatcgcggagggccgcatccacaccccggcccacgcccgccaagccctcgat
gccggggcattcgccgtggtggtgggcacggccatcactcacccggcgtcgattacgggc
tggttcaagggcgcgatgcacgcgtag

DBGET integrated database retrieval system