KEGG   Paenarthrobacter aurescens: AAur_0825Help
Entry
AAur_0825         CDS       T00447                                 

Definition
(GenBank) putative dihydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00261  Monobactam biosynthesis
aau00300  Lysine biosynthesis
aau01100  Metabolic pathways
aau01110  Biosynthesis of secondary metabolites
aau01120  Microbial metabolism in diverse environments
aau01130  Biosynthesis of antibiotics
aau01230  Biosynthesis of amino acids
Module
aau_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    AAur_0825
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    AAur_0825
Enzymes [BR:aau01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     AAur_0825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS
Motif
Other DBs
NCBI-ProteinID: ABM07589
UniProt: A1R311
Position
complement(861170..862096)
Genome map
AA seq 308 aa AA seqDB search
MSTQFQGVIPPVITPRHADGSIDTASLKNVTKHLIDGGVSGLFVLGSSGEVPYLTNEERE
LVVSTIADANAGAVPLIVGANEQTTNRVIEEARKVVDLGADAIVVTSMYYAIGNAAETET
HFRSIHAAIEKPIFAYDVPVRTHFKLPTDLLVRLGRDGVIAGVKDSSGDDVSFRQLLLAA
KDIPNFDIFTGHEVVVDGALLGGAQGVVPGLGNVDPAGYRRLFDAAQAGDWALAAREQDR
LADVFEIVYTPNGGVSGGAAGLGAFKTALQVMGVIESNTMSSPMLSLNDSETAAIREILE
RNGLVEAS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgtccactcagttccaaggcgtcatccccccggtcatcactccccgccacgcagacggc
agcatcgacaccgcgtcgctgaagaacgtcaccaagcacctgatcgacggcggtgtctcc
ggccttttcgtcctgggctcctccggcgaagtcccctacctgaccaacgaagagcgtgaa
ttggtggtctccaccatcgccgacgccaacgccggagcagttccgctgatcgtgggcgcc
aacgagcagaccaccaaccgcgtgatcgaggaagcccgcaaggtggttgaccttggcgcc
gacgcgatcgtggtcacctccatgtactacgcgatcggcaacgccgcggaaaccgaaacc
cacttccgcagcatccacgccgccatcgagaagccgatcttcgcgtacgatgtcccggtt
cgcacgcacttcaagctgcccaccgacttgttggttcgcctcggccgtgacggcgtcatt
gccggtgtcaaggattcctcgggcgacgacgtttccttccgccaactgctcctcgcagcc
aaggacatccccaacttcgacatcttcaccggtcacgaggttgtggtggacggcgcgctc
ctgggcggcgcgcaaggtgttgtcccgggcctcggcaacgttgaccctgccggttaccgt
cgcctgttcgacgccgcacaggccggcgactgggctctcgcggcaagggagcaggaccgc
ttggccgacgtcttcgagatcgtctacacccccaacggcggcgtctccggcggcgccgct
ggtctgggtgcgttcaagacggcactgcaggtgatgggtgtcatcgagtccaacaccatg
agctcgccgatgctttccttgaacgattccgagactgccgcgattcgcgaaatcctggag
cggaacgggctggtcgaagcttcatga

DBGET integrated database retrieval system