KEGG   Paenarthrobacter aurescens: AAur_0827Help
Entry
AAur_0827         CDS       T00447                                 

Definition
(GenBank) putative ABC-type dipeptide/oligopeptide transport system, ATPase component
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02034  peptide/nickel transport system permease protein
Organism
aau  Paenarthrobacter aurescens
Pathway
aau02024  Quorum sensing
Module
aau_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:aau00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AAur_0827
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aau02000]
    AAur_0827
Transporters [BR:aau02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    AAur_0827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran BPD_transp_1 oligo_HPY OppC_N AAA_21 SMC_N AAA
Motif
Other DBs
NCBI-ProteinID: ABM08687
UniProt: A1R313
Position
complement(862946..865057)
Genome map
AA seq 703 aa AA seqDB search
MRSKLAERLSAPGIRFKALPWGSRIALLFLIVIVLAAIFAPVIAPHDPLETFIPATPPGA
EHFFGTDRLGRDIFSRLLFGAQSSLMIGLGAVALAILAGALLGSFAATSSKSVNEIIMRL
MDILMAFPGIALAAVLLAAFGNSVPTIIIAIAIIYTPQLARVVRANVLAQYGEDYVRAER
VIGAGRFYILVKHIVRNTAAPVLVFATVMVADAIILEASLSFLGAGVQDPAPSWGNVISY
GRNLVLSGGWWATTFAGVTILLTVLSLNILAEGLTDAMVNPKLRRAPVVKDDDGSAAVVA
VDTEVATSVAQASVVEEHELDGVRAASVGDVTSDVGASAVLTDVKLAAANPHLLLDRELE
LLAAIEAKRTDRLPQVSPEARNVLEVKNLSIRFPGRFGDIAIVDSVTFTVREGETMGLVG
ESGCGKSITSLAVMGLLPKTAQVTGSIKFDGKELLDANTKHSNPKAYEGLRGEQIAMVYQ
DALSSLNPSMKIKDQMEQLTKRGGRKTPAELLEMVKLDPVRTLASYPHELSGGQRQRVLI
AMALSRSPKIVVADEPTTALDVTVQKQVVDLLNELREQLGFAMVFVSHDLALVASLAHRI
TVMYAGQVVESAQASELLQNPKHEYTRGLLGAVLSIEADAVRLHQIPGTVPSPRDFATGD
RFAARSLRPDADPHQKLVLTTVASANGDDADHFWASHLKEDAK
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcaagctcgcagaacggctaagtgccccgggcattcgtttcaaagccctgccc
tggggctcccgtatcgccctgctcttcctcatcgtgattgtcctggcggccattttcgcg
ccggtcattgcaccgcacgatcctctggagacgttcattccagccaccccgccgggtgca
gagcacttcttcggcaccgaccgcttgggccgtgacatcttttcgcgtctcctcttcggt
gcacagtcgtcgctgatgatcggcctcggagcggttgccctggccatccttgccggtgca
ctcctcggttccttcgcggccacctccagcaagtccgtgaacgagatcatcatgcggctc
atggacatcctcatggcattccccggcatcgcgctggcggccgtgctgttggccgcgttc
ggcaactcggtgcccaccatcatcatcgcgatcgccatcatctacaccccgcaactggcc
cgcgtcgtccgcgccaacgtgctggcccagtacggcgaagactacgtccgcgccgagcgc
gtgatcggtgccggccgcttctacatcctggtcaagcacattgtccgcaacactgccgcg
cccgtgctggtgttcgccacggtcatggtggccgacgccatcatcctcgaagcctccctc
tccttcctgggcgctggcgttcaggaccctgcaccgtcatggggcaacgtcatttcctac
ggccgcaacctggtcctgtccggcggctggtgggccaccaccttcgccggtgtgaccatt
ctgctgaccgtgctgtccttgaacatcctggccgaaggcctcaccgacgccatggtcaat
ccgaagctgcggcgcgcgccggtagtgaaggacgacgacggttccgctgcagttgtcgcc
gtggacaccgaagttgccacatctgtggcccaggcctccgtggtggaggaacacgagctc
gacggcgtccgcgcggcttccgttggtgacgtcacgtctgatgtgggcgcttcagccgtg
ctgaccgatgtgaagctggccgccgccaacccgcatctcctgctggaccgcgagttggaa
ctgctggcagccattgaagcgaagcgcaccgaccgactcccgcaggtttctcccgaagcc
cgcaacgtgcttgaagtgaaaaacctgtccatccgtttcccgggccgcttcggcgacatc
gcgatcgtggacagcgtcacgttcacggtccgcgaaggcgaaaccatgggcctggtaggc
gaatccggttgcggcaagtccatcacctcgctggccgtcatggggctgctgcccaaaaca
gcccaggtcaccggctccatcaagttcgatggcaaggaactcttggatgccaacaccaag
cacagcaaccccaaggcctacgagggtctccgcggcgagcagattgccatggtgtaccag
gacgccctgagctccctgaacccgtccatgaaaatcaaggaccagatggagcagctcacc
aagcgcggtggccgcaagacgccggcagagcttctggaaatggtgaaactggacccggtc
cggaccctcgccagctacccgcacgagctttccggcggccaacgccagcgcgtgctgatt
gccatggctttgtcccgctcgcccaagattgttgttgccgatgaacccactactgccctg
gatgtcactgtccagaagcaggttgtggacctgctcaacgaactccgcgagcagctgggc
ttcgccatggtcttcgtcagccacgaccttgccttggtggcatccttggcgcaccgcatc
acggtgatgtacgccggccaggtggtggaatccgcacaggcatccgaactcctgcagaac
cccaagcacgagtacacccggggcctgctgggcgcggtcctctccatcgaggccgacgcc
gtccgcctgcaccagattcccggcacggtcccgtcgcctcgcgacttcgctacgggcgac
cgcttcgcggcccgctcgttgaggcccgacgccgatccccaccagaagctggtcctcacc
accgttgcttcggcgaacggcgacgatgccgaccacttctgggcgagccacctgaaggag
gacgcgaaatga

DBGET integrated database retrieval system