KEGG   Paenarthrobacter aurescens: AAur_0828Help
Entry
AAur_0828         CDS       T00447                                 

Definition
(GenBank) putative ABC-type dipeptide/oligopeptide transport systems, permease components
  KO
K02033  peptide/nickel transport system permease protein
Organism
aau  Paenarthrobacter aurescens
Pathway
aau02024  Quorum sensing
Module
aau_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:aau00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AAur_0828
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aau02000]
    AAur_0828
Transporters [BR:aau02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    AAur_0828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABM09273
UniProt: A1R314
Position
complement(865061..866017)
Genome map
AA seq 318 aa AA seqDB search
MVTILRLLGRRLAALPLMILGITLLVFLVLQAAPGDQASSALGDGASEEAKQQYRQENGL
NDSLVLQYFRFLGKLLQFDLGVTTPPAKSVASMIGSAFPLTLQLTFLGVLIAIVLSLAFG
ILGALYRDKWQDQLVRVFSIAAIATPSFWLGILLIQWFALGANPMFPSGGIATPESGFGG
WLNSMALPALALGIPVSASLIRVVRTSMVEELDRDYVRTAIGNGVPYREVVSKNVLRNAL
VTPVTVLGLRVGYLLGGAVVIEMIFALPGMGQLILNGITNLDVNLVQGVVLTISVTFVLV
NIVVDLLYLLINPRIRTV
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
ttggtcacgatattgcgtctgcttggccgcaggcttgcagcattgccattgatgatcctg
ggcatcacgttgctcgtcttcctcgttctgcaggccgcccccggcgaccaggccagctcc
gccctcggcgacggtgccagcgaagaagcgaaacagcagtaccgccaggaaaatggcctc
aacgattccctggtcctgcagtacttccgattcctcggcaagctcctgcagttcgacctc
ggcgtcaccaccccgccggccaaatcggtggcttccatgatcggctcggcgttccccctg
acgctgcagctcaccttcctgggcgtgcttatcgcgatagtgctctcgctcgcgttcggc
atcctcggcgccctgtaccgcgataaatggcaggaccagctggtccgagtcttctccatc
gccgcgatcgccacgccgtcgttttggctgggcatcctcctcatccagtggttcgctctc
ggtgccaacccgatgttcccctcaggcggaattgcgacgccggaatccggtttcggcggt
tggctcaactcgatggccctcccggctttggcgctcggcatccctgtgtcagcgtcgctg
atccgagtggtccgtacgtcgatggtggaagaactggaccgggactacgtccgtacagcc
atcggcaacggtgtcccctaccgcgaggtggtctccaagaacgtcctccgcaacgccctc
gtcaccccggtgaccgtgctgggactgcgcgtcggctacttgctgggcggcgccgtcgtg
attgaaatgatcttcgccctgcccggtatgggacaactgatcctcaacggcatcaccaac
ctggacgtcaacctggtccagggcgtggtgctcaccatctccgtcaccttcgttctggtg
aacatcgtggtggaccttctctacctgctcatcaacccccgaatcaggacggtatag

DBGET integrated database retrieval system