KEGG   Paenarthrobacter aurescens: AAur_0832Help
Entry
AAur_0832         CDS       T00447                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00010  Glycolysis / Gluconeogenesis
aau00020  Citrate cycle (TCA cycle)
aau00620  Pyruvate metabolism
aau01100  Metabolic pathways
aau01110  Biosynthesis of secondary metabolites
aau01120  Microbial metabolism in diverse environments
aau01130  Biosynthesis of antibiotics
Module
aau_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAur_0832
   00020 Citrate cycle (TCA cycle)
    AAur_0832
   00620 Pyruvate metabolism
    AAur_0832
Enzymes [BR:aau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     AAur_0832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_C PEPCK_N DUF1580
Motif
Other DBs
NCBI-ProteinID: ABM06961
UniProt: A1R317
Position
869304..871130
Genome map
AA seq 608 aa AA seqDB search
MGDLARLPLLEKAPTTHARLLAWVEEVAELTQPDRIHWVDGSEAENKKLTDELVEAGTLK
RLNPETFPNSFAAFSDPADVARVEEQTFICSENERDAGFTNNWMAPAEMKQKLRGLFAGS
MRGRTMYVIPFVMGHLDAEDPKFGVEITDSAYVVASMRIMARIGTDVLDRITQTDAFFVP
ALHSLGAPLEAGQADVAWPCNTDKWIVHFPEERSIWSFGSGYGGNALLGKKCYALRIASV
MARDEGWLAEHMLILKLTSPEQKTYYISAAFPSACGKTNLALLDPTIKGWKVETLGDDIT
WMRFGKEGELRAVNPEAGLFGVAPGTGWGTNPNAMRAIAKGNSIFTNVALTDDGGVWWEG
MTEETPAHLTDWRGESWTPDSDAPAAHPNSRFCTPIDQIDMLAEEYFSPEGVELSAILFG
GRRKTTIPLVTEARNWSNGIFMGSTLSSETTAAAAGAVGVVRRDPMAMLPFIGYDAGDYL
NHWVNLSAKANPERLPKIFLVNWFRRTAEGGFAWPGFGDNARVLKWAIERLEGKADAVET
PIGFVPTGESIDLEGLDMTPAEVESAVRVDPAEWATELASIEEWFANFGESLPAALQSEL
DGLKTRLG
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatctggcgcgactgccgctgcttgagaaggcacctactacgcatgcacgcctg
ctggcctgggttgaggaagttgccgagctgactcagccggaccgcatccactgggttgat
ggcagcgaagcagaaaacaagaagctcaccgacgaactcgtcgaagccggcacgctgaag
cgactgaacccggaaacgttcccgaattccttcgcggcgttctccgaccccgcagacgtt
gcccgtgtggaagagcagaccttcatctgctccgaaaacgagcgcgacgcaggcttcacc
aacaactggatggccccggccgagatgaagcagaagctgcgcggactattcgccggctcc
atgcgcggccgcaccatgtacgtcattccgttcgtcatgggccacctggatgccgaggat
cccaagtttggcgtcgagatcaccgactccgcctacgttgtcgcctccatgcgcatcatg
gcccgcatcggcactgacgtcctggatcgcatcacgcagactgacgctttcttcgtaccg
gccctccactcactgggcgcacctctggaagccggccaggccgacgtcgcatggccgtgc
aacaccgacaagtggattgtgcacttccccgaagagcgctccatctggtccttcggctcc
ggctacggcggaaacgccctccttggaaagaagtgctacgcgctgcgcatcgcttcggtg
atggcccgtgacgaaggctggctggccgagcacatgctcatcctcaagctgacctccccc
gagcagaagacctactacatctccgccgctttcccgtccgcttgcggcaagaccaacctc
gcgttgctcgaccccaccatcaagggctggaaggttgagaccctgggtgatgacatcacc
tggatgcgcttcggcaaggaaggcgagctccgcgctgtcaaccccgaggccggcctgttc
ggcgtcgctcccggcaccggctggggcaccaaccccaacgccatgcgtgccatcgcgaag
ggcaacagcatcttcaccaacgtcgccctgaccgacgacggtggcgtctggtgggaaggc
atgaccgaggaaaccccggcacacctgaccgactggcgtggcgagtcctggactccggac
tctgacgccccggccgcgcacccgaactcccgcttctgcacgccgatcgaccagatcgac
atgctggccgaagagtacttcagcccggaaggcgtggaactgtccgcgatcctgttcggc
ggccgccgcaagaccaccatcccgctggtcactgaggcccgcaactggtccaacggcatc
ttcatgggctccacgctgtcttccgaaaccacggctgctgccgccggtgccgttggcgtc
gtccgtcgcgaccccatggccatgctgccgttcatcggctacgacgcaggtgactacctg
aaccactgggtgaacctgtccgccaaggccaacccggagcgtctgcccaagatcttcctg
gtcaactggttccgtcgcacggctgaaggcggcttcgcctggcctggcttcggcgacaac
gcccgtgtgctcaagtgggccatcgagcgcctcgaaggcaaggccgacgccgtggagacc
ccgatcggttttgtaccgaccggcgaatccatcgacctcgaaggcctggacatgaccccg
gctgaggttgagtcggctgttcgcgttgacccggccgagtgggcaaccgagctggcgtcc
atcgaggaatggttcgccaacttcggcgaatccctcccggcggcacttcagtccgagctg
gacggtctcaagacccgtctgggctag

DBGET integrated database retrieval system