KEGG   Paenarthrobacter aurescens: AAur_0835Help
Entry
AAur_0835         CDS       T00447                                 

Definition
(GenBank) hypothetical protein
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABM07840
UniProt: A1R320
Position
complement(873057..873506)
Genome map
AA seq 149 aa AA seqDB search
MSETASTDPPESVQDRELRETLGTALGTAQEHIQQNGGFFPFGVTLSNDGELRIVMIAPG
EPDENGEVDAGQMLTDIHDLLRQGRDDFKAVAVVSDVNLPDHGSDGIHGAAEHRDGEVRA
AIIPYTPTVDGFAFSAMEPDTHEPSIWVD
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaccgcctccaccgatccccccgaatcagtccaggaccgcgaactccgcgag
acactgggcactgcactcgggaccgcgcaggagcacatccagcagaacggcggcttcttc
ccgttcggagtcacactgtccaacgatggtgaactacggatagtgatgattgccccgggc
gagccggacgagaatggcgaagtggatgcaggacagatgttgaccgacatccatgacctg
ctgcgccaaggccgcgatgattttaaggctgtagcagttgtgagcgacgtcaatctgccg
gaccatggttctgacggcattcatggtgcagccgagcacagggatggcgaagtccgtgcg
gccattattccgtacacgcccacagtggacggattcgcctttagcgccatggaacctgat
acccacgaaccatccatctgggtggactag

DBGET integrated database retrieval system