KEGG   Paenarthrobacter aurescens: AAur_0836Help
Entry
AAur_0836         CDS       T00447                                 

Gene name
manB
Definition
(GenBank) phosphomannomutase
  KO
K01840  phosphomannomutase [EC:5.4.2.8]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00051  Fructose and mannose metabolism
aau00520  Amino sugar and nucleotide sugar metabolism
aau01100  Metabolic pathways
aau01110  Biosynthesis of secondary metabolites
aau01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AAur_0836 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    AAur_0836 (manB)
Enzymes [BR:aau01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     AAur_0836 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ABM08675
UniProt: A1R321
Position
complement(873519..874937)
Genome map
AA seq 472 aa AA seqDB search
MTIEQNKTFDLSASFKAYDVRGIVGESITAEIVEAVGAAFIDVLGLEGETVLVGGDMRPS
SPEFSRAFANGAATRGANVQLLDLISTDELYYACGALNAAGATFTASHNPAAYNGIKMAK
AGAQPISSESGLKEIQALAEQYLNTGTIPAAVTRGEIGVHDVLKDYSEYLRKLVDLSGSR
PLKIVVDAGNGMAGLTTPAVLGDKLLPALPFEIIPLYFELDGSFPNHPANPLEPENLRDL
QAAVIKHGADIGLAFDGDADRCFVIDEKGEPVSPSAITGMVARREIARAQAAGEETPVII
HNLLTSKAVPELVAKDGGRAVRTRVGHSFIKAVMAEEGAVFGGEHSAHFYFRDFWNADTG
MLAAMHVLAALGEQDGPLSELGRQYEPYVSSGEINSEIEDKAGAVERVRVDFETEDIDID
HMDGSTFTAKDGSWWFNLRPSNTEPFLRLNAEAKDQATMEKIRDRVLALVRA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtgactatcgagcagaacaagacattcgacctctcggcttccttcaaggcatacgacgtc
cggggcatcgtgggtgaatccatcacggctgaaatcgtcgaggccgtaggcgctgccttc
atcgatgtcttgggactcgagggcgaaacggtccttgttggcggcgacatgcgtccctca
tcgccggagttcagccgcgcctttgccaacggtgcagcaacgcgcggagcgaacgtccaa
ctgctcgacctgatctctaccgacgagctctactacgcatgtggcgccctcaacgctgcc
ggtgccacgttcacggcaagccataatccggccgcctacaacggcatcaagatggcaaag
gccggcgcccagcccatctcttccgagagtgggctcaaggaaatccaggccctcgctgag
cagtacctgaacaccggcaccatccctgcggcggtcactcgcggcgagattggcgtgcac
gacgtcctgaaggactactccgaatacttgcgcaaactggtggacctgtccgggtcccgc
ccgctgaagatcgtggtggatgcagggaacggcatggctggtttgaccaccccggctgtc
ttgggcgacaaattgctcccggctctgccctttgaaatcatcccgctctactttgaactg
gacggttcatttcccaaccacccggccaaccctctggagccggaaaacctgcgcgacctg
caggccgctgtcatcaagcacggcgccgacattggcctcgcgttcgacggcgacgcggac
cgctgctttgtcatcgacgaaaagggcgagcccgtttccccgtcagcgatcacgggcatg
gtggcccggcgtgagatcgcccgggcccaggccgcaggggaagagacccccgtcatcatc
cacaacctccttacctccaaggccgtgccagagctcgtagccaaggacggcggccgtgcc
gtacgtacccgcgtaggacactccttcatcaaggctgtcatggcggaggaaggcgccgtg
ttcggcggggagcactccgcgcacttctatttccgggatttctggaacgcggatacgggc
atgcttgccgcaatgcacgtccttgccgccttgggtgagcaggacggacctctctcggag
ctgggccgccagtacgagccctacgtctcctccggcgagatcaactccgaaatcgaagac
aaggccggcgccgtcgagcgcgttcgcgtcgacttcgaaaccgaagacatcgacatcgac
cacatggacggcagcacgttcacagcaaaggacggtagctggtggttcaaccttcgcccg
tccaacactgagcccttccttcgcctgaatgcagaagccaaggaccaagccaccatggaa
aagatccgcgaccgcgtcctggcgctggtccgggcgtag

DBGET integrated database retrieval system