KEGG   Paenarthrobacter aurescens: AAur_0844Help
Entry
AAur_0844         CDS       T00447                                 

Definition
(GenBank) putative glyoxalase family protein
  KO
K06996  uncharacterized protein
Organism
aau  Paenarthrobacter aurescens
Brite
KEGG Orthology (KO) [BR:aau00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    AAur_0844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase Glyoxalase_4 LppA Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ABM07892
UniProt: A1R328
Position
complement(889984..890769)
Genome map
AA seq 261 aa AA seqDB search
MPKPDITPGSPCWIDLVTSDTEKAKAFYTALFGWTYETGDQEKYGGYITASKNGRMVAGI
MEKQADMGAMPDVWSTYLRTDDIKATTEAAAANGGRVLMEPMEVPEQGSMAMYGDASGAA
IGAWQFGEMKGYEVAAEAGAPAWHELLSKDYESAVTFYQKVFGWDTEVMSDTPEFRYTTL
GAGDDAKAGIMDASGFLPEQVPSMWSVYFAVEDTDATAERAASLGATIMQPAEDTPFGRL
ATLSDPTGAVFKVIQDLGQTA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagcctgacatcactcccggttccccctgctggatcgaccttgtgacgtccgat
acggagaaggccaaggccttttacacggcacttttcggctggacctatgaaaccggagac
caggaaaagtacggcggctacatcacggcttccaagaatggccggatggttgcgggcatc
atggagaagcaggcggacatgggggccatgccggacgtttggtccacctaccttcgcacc
gacgacatcaaagcaaccaccgaggccgctgccgccaacggcggccgggtgctcatggaa
cccatggaggtccccgagcaaggcagcatggccatgtacggggatgcctcaggcgccgca
atcggcgcctggcagttcggtgaaatgaagggctatgaggtggcggctgaggccggagct
cccgcctggcatgaactgctttccaaggactacgagtccgcggtcactttctaccagaag
gtcttcggctgggacacggaggtcatgagcgacactccggaattccgatacacaaccctg
ggtgccggtgacgacgccaaggcgggcatcatggatgcctccggtttcctgcccgagcag
gtcccctccatgtggagtgtgtatttcgcggtggaagacacggacgccactgctgagcga
gccgcgtccctcggtgccaccattatgcagcccgccgaggacacacccttcgggcgcttg
gccacgttatcggaccccaccggcgccgttttcaaggtgatccaggacttgggccagacc
gcctag

DBGET integrated database retrieval system