KEGG   Paenarthrobacter aurescens: AAur_0847Help
Entry
AAur_0847         CDS       T00447                                 

Definition
(GenBank) putative transcriptional regulator, PadR family
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PadR Vir_act_alpha_C HTH_27
Motif
Other DBs
NCBI-ProteinID: ABM07039
UniProt: A1R330
Position
892166..892705
Genome map
AA seq 179 aa AA seqDB search
MSIRHSLLALLQDQPRYGYELRVEFEDRTGAAWPLNIGQVYTTLDRLERDGLVSKDGDDG
GGHVVYSITDAGAEEVEAWFAGAVDRGNPPRNEIAIKLALAVSLPDVDTSAVIQSQREVS
VKALQEHTQARKAVSANQRSSDTAWLLVLDSLIFQAEAEVRWLDLCEARMVQVQRRPGE
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgtccatccggcacagcttgctggccctgcttcaggaccagccccggtacggctatgag
ctgcgcgtcgaattcgaggacaggaccggggcagcctggccgttgaacatcggccaggtg
tacacaacgctggaccggctggagcgcgacggcctggtcagcaaagacggcgacgacggc
ggcgggcacgtcgtgtacagcatcaccgacgccggggctgaggaagtcgaagcgtggttc
gccggcgcagtggaccgaggcaatcctccacgaaacgaaattgccatcaagttggcgctc
gcggtgtcgcttccggacgtggatacctctgcggtgatccagtcccaacgggaagtctcg
gtcaaggctctgcaggaacatacgcaggcgagaaaggcggtctccgccaaccaacgatcg
tcggataccgcctggctcctggtgctcgattcactgattttccaggccgaagcggaagtt
cgatggttggatctctgcgaggcgcgcatggtgcaagttcagcgccggccgggagagtga

DBGET integrated database retrieval system