KEGG   Paenarthrobacter aurescens: AAur_0856Help
Entry
AAur_0856         CDS       T00447                                 

Definition
(GenBank) putative integral membrane protein
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABM06403
UniProt: A1R339
Position
901531..902265
Genome map
AA seq 244 aa AA seqDB search
MSSITSAPATTSTAMADFNRTTSRWGQITMIGGLLISVAGPLYLVFATGLDIGPAQLWIA
FAAVAATFGIIWIVEPLTYYPILGPAAMYQAFMIGNISNKLLPAALIAQTNIGAKPGSKR
AELAAVVAICGAAVVHLISLAIFVGLLGSWLISVIPPSVLLVTRLYVLPTVLGAVLVQAI
VSMKQPRTTVFALLVSAVVVFVVLPLVPSLAMVSTAIAVLGTILLAWFFRGKAAITESKP
IHIE
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccatcacttccgctcccgccaccactagcaccgccatggcggacttcaaccgc
accacctcccgctggggccagatcaccatgatcggcggcctgctcatctccgtggccggt
cccttgtacttggtcttcgccaccggcctggacataggcccggcccaactctggatcgcg
ttcgcagccgttgctgccacgttcggcatcatctggatcgtcgagccactcacgtactac
cccatccttggacctgccgcgatgtaccaggcgttcatgatcggcaacatctccaacaag
ctcctgccggcggcgctgatcgcccaaaccaacatcggcgcaaagccgggcagcaagcgg
gcggaactggccgccgtcgtcgccatttgcggagccgccgtagtccacctgatctcgctg
gcgatctttgttggcctgctgggtagctggctgatcagtgtcatcccaccgtcggtattg
ctcgtcacccggctttacgtgctgcccaccgttcttggcgccgtactggtacaggcgatc
gtatccatgaagcaaccccgcaccaccgtgttcgccttgctggtctcagccgtcgtcgtg
ttcgttgtgctgccgctggtgccgtcgctcgcgatggtgtcaaccgccattgccgttctg
ggcaccatcctgctggcgtggttcttccgagggaaagccgccatcactgaatcgaagccc
atccacatcgagtag

DBGET integrated database retrieval system