KEGG   Paenarthrobacter aurescens: AAur_0871Help
Entry
AAur_0871         CDS       T00447                                 

Definition
(GenBank) putative NifU-like domain protein
Organism
aau  Paenarthrobacter aurescens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NifU
Motif
Other DBs
NCBI-ProteinID: ABM08921
UniProt: A1R354
Position
917024..917428
Genome map
AA seq 134 aa AA seqDB search
MTTTQNAGPLEEDLQEALSYIRPLLKGHSGDLTIAAVDDGVVTVDFHNACHSCPAISVTF
AGLVRSRLMQVDGVKDVRSSQVHASRRALDRIAATLGGPAHYRPAQSTSRSSLPLLPKQP
SACQPLAIADAGGR
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaccacccagaacgcgggccctttggaagaggaccttcaagaggcactgtcctat
attcggcccctgcttaagggccactccggcgacctgacaatcgcagctgttgacgacggt
gtggtcaccgttgacttccacaatgcctgccactcatgccctgctatttcggtgacgttc
gccggcctcgtccggtcccgcctgatgcaggtggacggcgtcaaagatgtcaggtcttcg
caggtccatgcatcacggcgggccttggaccgcatcgcagccacgctgggaggccctgcg
cactacaggcctgcccagtccacctccagatcgtcgcttccgctgctacccaagcagccc
tctgcctgccaaccgttggcaatcgccgacgcaggaggacgttga

DBGET integrated database retrieval system