KEGG   Paenarthrobacter aurescens: AAur_0873Help
Entry
AAur_0873         CDS       T00447                                 

Definition
(GenBank) putative ribose ABC transporter
  KO
K10439  ribose transport system substrate-binding protein
Organism
aau  Paenarthrobacter aurescens
Pathway
aau02010  ABC transporters
Module
aau_M00212  Ribose transport system
Brite
KEGG Orthology (KO) [BR:aau00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    AAur_0873
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    AAur_0873
Transporters [BR:aau02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212] [OT]
    AAur_0873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Peripla_BP_3 TPP_enzyme_N Pox_A22 DUF2194
Motif
Other DBs
NCBI-ProteinID: ABM09859
UniProt: A1R356
Position
918515..919459
Genome map
AA seq 314 aa AA seqDB search
MAMLATAALALTGCSADNAANAGGTGKKTIGVSMPEFHSLFYVAAVDGMKKAAADEGYEL
VVLNANGNSSQQVNQVQNLVTQQVGAVIFAMQDATAGAAGVAEAKGANIPVIAIDQRPQG
DVTTFIGSDSVKASTELCDYLAKQMGGKGNLAIIKGVLGSSTEIERSKGCGSILEKNPDI
KVVSTTNADWDENKAYNVAQDVLTANPELQAIFAQNDGMALGAAKAAAQAGRSNLKIVSV
DGFPQVYDAIESGQVLATMSQEPYQMGELAVRTAIKAMSGEAGSIQKEQLQPTVLVTKEN
LEEARSAGYYGPAK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
ttggcaatgcttgccacagccgctttggctctgactggttgcagcgcggacaacgccgcc
aatgcaggcgggacgggcaagaagacaatcggtgtttcgatgcctgaatttcattccctc
ttttatgtcgcagctgttgacggcatgaagaaggccgctgctgacgagggctacgagctc
gtggtcctcaatgcgaatggcaattcttcgcagcaggtcaaccaggtgcagaacctggtg
acacagcaagtcggggcagtcatctttgccatgcaggatgcaacagccggcgcagcggga
gtggcggaggcgaagggcgccaatatccccgtcattgccatcgaccagcgccctcaaggc
gatgtgaccacgttcattggcagcgacagcgttaaggcgtccaccgagttgtgtgactac
ctggccaagcagatgggcggcaagggtaacctcgccatcatcaagggtgttctcgggtct
tctacggaaattgagcgttccaagggatgcggaagcattttggagaagaacccggacatc
aaggtggtctccactaccaacgctgactgggacgagaacaaggcctataacgtggcgcag
gacgtgctgactgccaacccggagctgcaggcaatcttcgcgcaaaacgatggaatggcc
ctcggtgctgccaaggccgcagcccaagccggccgctccaacctcaagatcgtcagcgtg
gacggtttcccacaggtttacgacgccatcgagtccggacaggttttggccacgatgtcg
caggaaccgtatcaaatgggcgagcttgccgtccgcactgccatcaaagccatgagcggc
gaggccgggtccattcagaaggaacagttgcagcccaccgtcctggtcactaaggaaaac
ctcgaagaggcccgttccgccggatactacggccccgcgaaatag

DBGET integrated database retrieval system